APRR7_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APRR7_ARATH
• UniProt AC: Q93WK5
• Protein Name: Two-component response regulator-like APRR7
• Gene Name: APRR7
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 727
• Subcellular Localization: Nucleus .
• Protein Description: Transcriptional repressor of CCA1 and LHY, and positive regulator of LWD1 and LWD2 expression. Represses the expression of other clock proteins and master regulators of plant growth, development and response to abiotic stress. Involved in the positive and negative feedback loops of the circadian clock. Controls photoperiodic flowering response and temperature compensation. Expression of several members of the ARR-like family is controlled by circadian rhythm. APRR9, APRR7, and APRR5 coordinately act on the upstream region of the target genes to repress their expression from noon until midnight. The particular coordinated sequential expression of APRR9, APRR7, APRR5, APRR3 and APPR1 result to circadian waves that may be at the basis of the endogenous circadian clock..
• Protein Sequence: MNANEEGEGSRYPITDRKTGETKFDRVESRTEKHSEEEKTNGITMDVRNGSSGGLQIPLSQQTAATVCWERFLHVRTIRVLLVENDDCTRYIVTALLRNCSYEVVEASNGIQAWKVLEDLNNHIDIVLTEVIMPYLSGIGLLCKILNHKSRRNIPVIMMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKILWQHVWRRCQSSSGSGSESGTHQTQKSVKSKSIKKSDQDSGSSDENENGSIGLNASDGSSDGSGAQSSWTKKAVDVDDSPRAVSLWDRVDSTCAQVVHSNPEFPSNQLVAPPAEKETQEHDDKFEDVTMGRDLEISIRRNCDLALEPKDEPLSKTTGIMRQDNSFEKSSSKWKMKVGKGPLDLSSESPSSKQMHEDGGSSFKAMSSHLQDNREPEAPNTHLKTLDTNEASVKISEELMHVEHSSKRHRGTKDDGTLVRDDRNVLRRSEGSAFSRYNPASNANKISGGNLGSTSLQDNNSQDLIKKTEAAYDCHSNMNESLPHNHRSHVGSNNFDMSSTTENNAFTKPGAPKVSSAGSSSVKHSSFQPLPCDHHNNHASYNLVHVAERKKLPPQCGSSNVYNETIEGNNNTVNYSVNGSVSGSGHGSNGPYGSSNGMNAGGMNMGSDNGAGKNGNGDGSGSGSGSGSGNLADENKISQREAALTKFRQKRKERCFRKKVRYQSRKKLAEQRPRVRGQFVRKTAAATDDNDIKNIEDS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
270	Phosphorylation	KAVDVDDSPRAVSLW EEECCCCCCCHHHHH	16.30	25561503
375	Phosphorylation	GKGPLDLSSESPSSK CCCCCCCCCCCCCCC	31.55	30291188
376	Phosphorylation	KGPLDLSSESPSSKQ CCCCCCCCCCCCCCC	49.76	25561503
378	Phosphorylation	PLDLSSESPSSKQMH CCCCCCCCCCCCCCC	31.84	30291188
484	Phosphorylation	GGNLGSTSLQDNNSQ CCCCCCCCCCCCCHH	26.23	30291188
490	Phosphorylation	TSLQDNNSQDLIKKT CCCCCCCHHHHHHHH	31.18	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APRR7_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APRR7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APRR7_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PHYA_ARATH	PHYA	genetic	14563930
APRR9_ARATH	PRR9	genetic	15649364
APRR9_ARATH	PRR9	genetic	15767265
APRR5_ARATH	PRR5	genetic	15767265
APRR9_ARATH	PRR9	genetic	15705949
APRR5_ARATH	PRR5	genetic	17519251
LHY_ARATH	LHY	genetic	17519251
CCA1_ARATH	CCA1	genetic	17519251
PHYB_ARATH	PHYB	genetic	17519251
APRR5_ARATH	PRR5	genetic	17504813
LHY_ARATH	LHY	genetic	17504813
CCA1_ARATH	CCA1	genetic	17504813
APRR5_ARATH	PRR5	genetic	15695441
TPL_ARATH	TPL	physical	23267111

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.