| UniProt ID | ALFL6_ARATH | |
|---|---|---|
| UniProt AC | Q8S8M9 | |
| Protein Name | PHD finger protein ALFIN-LIKE 6 | |
| Gene Name | AL6 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 256 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.. | |
| Protein Sequence | MEGITHPIPRTVEEVFSDFRGRRAGLIKALTNDMVKFYQTCDPEKENLCLYGLPNETWEVNLPVEEVPPELPEPALGINFARDGMQEKDWVSLVAVHSDSWLLSVAFYFGARFGFGKNERKRLFQMINELPTIFEVVSGNAKQSKDLSVNNNNSKSKPSGVKSRQSESLSKVAKMSSPPPKEEEEEEDESEDESEDDEQGAVCGACGDNYGTDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPTCSNKRARP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 148 | Phosphorylation | AKQSKDLSVNNNNSK CCCCCCCCCCCCCCC | 32.69 | 19880383 | |
| 154 | Phosphorylation | LSVNNNNSKSKPSGV CCCCCCCCCCCCCCC | 40.19 | 19880383 | |
| 156 | Phosphorylation | VNNNNSKSKPSGVKS CCCCCCCCCCCCCCC | 50.01 | 19880383 | |
| 159 | Phosphorylation | NNSKSKPSGVKSRQS CCCCCCCCCCCCCCH | 61.01 | 19880383 | |
| 163 | Phosphorylation | SKPSGVKSRQSESLS CCCCCCCCCCHHHHH | 32.90 | 19880383 | |
| 166 | Phosphorylation | SGVKSRQSESLSKVA CCCCCCCHHHHHHHH | 28.22 | 19880383 | |
| 168 | Phosphorylation | VKSRQSESLSKVAKM CCCCCHHHHHHHHHH | 43.09 | 19880383 | |
| 170 | Phosphorylation | SRQSESLSKVAKMSS CCCHHHHHHHHHHCC | 34.07 | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ALFL6_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ALFL6_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ALFL6_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ASHR3_ARATH | SDG4 | physical | 21798944 | |
| ALFL5_ARATH | AL5 | genetic | 25619813 | |
| ALFL1_ARATH | AL1 | physical | 24465219 | |
| ALFL2_ARATH | AL2 | physical | 24465219 | |
| ALFL5_ARATH | AL5 | physical | 24465219 | |
| ALFL6_ARATH | AL6 | physical | 24465219 | |
| ALFL7_ARATH | AL7 | physical | 24465219 | |
| RNG1A_ARATH | RING1A | physical | 24465219 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
