| UniProt ID | ALFL2_ARATH | |
|---|---|---|
| UniProt AC | Q9SRM4 | |
| Protein Name | PHD finger protein ALFIN-LIKE 2 | |
| Gene Name | AL2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 246 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.. | |
| Protein Sequence | MAAAAVSSNPRTVEEIFKDYSARRAALLRALTKDVDDFYSQCDPEKENLCLYGHPNESWEVNLPAEEVPPELPEPALGINFARDGMQRKDWLSLVAVHSDCWLLSVSFYFGARLNRNERKRLFSLINDLPTLFDVVTGRKAMKDNKPSSDSGSKSRNGTKRSIDGQTKSSTPKLMEESYEEEEEEDEHGDTLCGSCGGHYTNEEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPPCCAKKGRQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MAAAAVSS -------CCCCHHCC | 5.30 | - | |
| 2 | Acetylation | ------MAAAAVSSN ------CCCCHHCCC | 13.05 | 22223895 | |
| 148 | Phosphorylation | AMKDNKPSSDSGSKS HHCCCCCCCCCCCCC | 48.68 | 25561503 | |
| 149 | Phosphorylation | MKDNKPSSDSGSKSR HCCCCCCCCCCCCCC | 44.30 | 25561503 | |
| 151 | Phosphorylation | DNKPSSDSGSKSRNG CCCCCCCCCCCCCCC | 47.08 | 25561503 | |
| 153 | Phosphorylation | KPSSDSGSKSRNGTK CCCCCCCCCCCCCCC | 31.26 | 25561503 | |
| 162 | Phosphorylation | SRNGTKRSIDGQTKS CCCCCCCCCCCCCCC | 26.96 | 23172892 | |
| 167 | Phosphorylation | KRSIDGQTKSSTPKL CCCCCCCCCCCCCCH | 38.12 | 19880383 | |
| 169 | Phosphorylation | SIDGQTKSSTPKLME CCCCCCCCCCCCHHH | 42.71 | 23172892 | |
| 170 | Phosphorylation | IDGQTKSSTPKLMEE CCCCCCCCCCCHHHH | 50.73 | 23172892 | |
| 171 | Phosphorylation | DGQTKSSTPKLMEES CCCCCCCCCCHHHHH | 31.37 | 23172892 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ALFL2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ALFL2_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ALFL2_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RNG1A_ARATH | RING1A | physical | 24465219 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
