ALFL7_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ALFL7_ARATH
• UniProt AC: Q8LA16
• Protein Name: PHD finger protein ALFIN-LIKE 7
• Gene Name: AL7
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 252
• Subcellular Localization: Nucleus .
• Protein Description: Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes..
• Protein Sequence: MEGIQHPIPRTVEEVFSDFRGRRAGLIKALSTDVQKFYHQCDPEKENLCLYGLPNETWEVNLPVEEVPPELPEPALGINFARDGMQEKDWISLVAVHSDSWLISVAFYFGARFGFGKNERKRLFQMINDLPTIFEVVTGNAKQSKDQSANHNSSRSKSSGGKPRHSESHTKASKMSPPPRKEDESGDEDEDDEQGAVCGACGDNYGGDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPSCTTSKKMKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
176	Phosphorylation	HTKASKMSPPPRKED CCCHHHCCCCCCCCC	37.68	19154204
185	Phosphorylation	PPRKEDESGDEDEDD CCCCCCCCCCCCCCC	64.96	23776212
205	Phosphorylation	CGACGDNYGGDEFWI CCCCCCCCCCCCEEE	27.50	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ALFL7_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ALFL7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ALFL7_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ALFL2_ARATH	AL2	physical	21798944
RNG1A_ARATH	RING1A	physical	24465219

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.