UniProt ID | ALFL7_ARATH | |
---|---|---|
UniProt AC | Q8LA16 | |
Protein Name | PHD finger protein ALFIN-LIKE 7 | |
Gene Name | AL7 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 252 | |
Subcellular Localization | Nucleus . | |
Protein Description | Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.. | |
Protein Sequence | MEGIQHPIPRTVEEVFSDFRGRRAGLIKALSTDVQKFYHQCDPEKENLCLYGLPNETWEVNLPVEEVPPELPEPALGINFARDGMQEKDWISLVAVHSDSWLISVAFYFGARFGFGKNERKRLFQMINDLPTIFEVVTGNAKQSKDQSANHNSSRSKSSGGKPRHSESHTKASKMSPPPRKEDESGDEDEDDEQGAVCGACGDNYGGDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPSCTTSKKMKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
176 | Phosphorylation | HTKASKMSPPPRKED CCCHHHCCCCCCCCC | 37.68 | 19154204 | |
185 | Phosphorylation | PPRKEDESGDEDEDD CCCCCCCCCCCCCCC | 64.96 | 23776212 | |
205 | Phosphorylation | CGACGDNYGGDEFWI CCCCCCCCCCCCEEE | 27.50 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ALFL7_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ALFL7_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ALFL7_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ALFL2_ARATH | AL2 | physical | 21798944 | |
RNG1A_ARATH | RING1A | physical | 24465219 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...