ALFL1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ALFL1_ARATH
• UniProt AC: Q9FFF5
• Protein Name: PHD finger protein ALFIN-LIKE 1
• Gene Name: AL1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 241
• Subcellular Localization: Nucleus .
• Protein Description: Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes..
• Protein Sequence: MAAESSNPRTVEEIFKDFSGRRSGFLRALSVDVDKFYSLCDPEMENLCLYGHPNGTWEVNLPAEEVPPELPEPALGINFARDGMQRKDWLSLVAVHSDCWLLSVSSYFGARLNRNERKRLFSLINDLPTLFEVVTGRKPIKDGKPSMDLGSKSRNGVKRSIEGQTKSTPKLMEESYEDEDDEHGDTLCGSCGGNYTNDEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPSCCTKKGRQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAESSNPR ------CCCCCCCCH	21.67	22223895
30	Phosphorylation	SGFLRALSVDVDKFY CCCEEEEEECHHHHH	18.45	25561503
151	Phosphorylation	KPSMDLGSKSRNGVK CCCCCCCCCCCCCCC	34.45	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ALFL1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ALFL1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ALFL1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ALFL1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.