AA2AR_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AA2AR_HUMAN
• UniProt AC: P29274
• Protein Name: Adenosine receptor A2a
• Gene Name: ADORA2A
• Organism: Homo sapiens (Human).
• Sequence Length: 412
• Subcellular Localization: Cell membrane; Multi-pass membrane protein.
• Protein Description: Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase..
• Protein Sequence: MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
154	N-linked_Glycosylation	GQPKEGKNHSQGCGE CCCCCCCCCCCCCCC	51.39	UniProtKB CARBOHYD
329	Phosphorylation	RVLAAHGSDGEQVSL EEEEECCCCCCEEEE	32.35	28060719
335	Phosphorylation	GSDGEQVSLRLNGHP CCCCCEEEEEECCCC	13.89	28060719
374	Phosphorylation	SGGSAQESQGNTGLP ECCCCCCCCCCCCCC	31.16	26835399

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AA2AR_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AA2AR_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AA2AR_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DRD2_HUMAN	DRD2	physical	12804599
AA2AR_HUMAN	ADORA2A	physical	12804599
ACTN1_MOUSE	Actn1	physical	12837758
ACTN2_MOUSE	Actn2	physical	12837758
ACTN3_MOUSE	Actn3	physical	12837758
ACTN4_MOUSE	Actn4	physical	12837758
AA2AR_HUMAN	ADORA2A	physical	12837758
CYH2_HUMAN	CYTH2	physical	16027149

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• D00045: Adenosine (JAN/USP); Adenocard (TN); Adenoscan (TN)
• D00227: Aminophylline (USP/INN); Somophyllin (TN); Theophylline ethylenediamine (TN)
• D00371: Theophylline (JP16); Elixophyllin (TN); Quibron-t (TN); Theo-24 (TN); Theodur G (TN); Theolair (TN);
• D00528: Anhydrous caffeine (JP16); Caffeine (USP); Anhydrous caffeine (TN)
• D01453: Caffeine hydrate (JP16); Caffeine monohydrate; Caffeine (TN)
• D01712: Theophylline sodium acetate (JAN)
• D01771: Proxyphylline (JAN/INN); Monophyllin (TN)
• D02017: Choline theophylline (JAN); Oxtriphylline (USP); Choline theophyllinate (INN); Theophyline - choline
• D03120: Binodenoson (USAN/INN)
• D03210: Ancriviroc (USAN/INN)
• D03212: Apadenoson (USAN)
• D04006: Enprofylline (USAN/INN)
• D04641: Istradefylline (JAN/USAN/INN); Nouriast (TN)
• D05429: Aminophylline hydrate (JP16)
• D05711: Regadenoson (USAN/INN); Lexiscan (TN)
• D06103: Theophylline (USP); Theophylline monohydrate; Accurbron (TN)
• D06104: Theophylline sodium glycinate (USP); Asbron (TN)
• D07603: Caffeine citrate (USP); Cafcit (TN)
• D09003: Sonedenoson (USAN)
• D09717: Preladenant (USAN/INN)
• D09991: Vipadenant (USAN/INN)
• D10174: Tozadenant (USAN)
• D10362: Evodenoson (USAN)
• DrugBank
• There are no disease associations of PTM sites.