UniProt ID | ZN576_HUMAN | |
---|---|---|
UniProt AC | Q9H609 | |
Protein Name | Zinc finger protein 576 | |
Gene Name | ZNF576 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 170 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in transcriptional regulation.. | |
Protein Sequence | MEDPNPEENMKQQDSPKERSPQSPGGNICHLGAPKCTRCLITFADSKFQERHMKREHPADFVAQKLQGVLFICFTCARSFPSSKALITHQRSHGPAAKPTLPVATTTAQPTFPCPDCGKTFGQAVSLRRHRQMHEVRAPPGTFACTECGQDFAQEAGLHQHYIRHARGEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | ENMKQQDSPKERSPQ HHHCCCCCCCCCCCC | 33.27 | 24719451 | |
20 | Phosphorylation | QDSPKERSPQSPGGN CCCCCCCCCCCCCCC | 28.51 | 25159151 | |
23 | Phosphorylation | PKERSPQSPGGNICH CCCCCCCCCCCCCCC | 28.97 | 25159151 | |
75 | Phosphorylation | GVLFICFTCARSFPS HHHHHHHHCCCCCCC | 10.80 | 25404012 | |
79 | Phosphorylation | ICFTCARSFPSSKAL HHHHCCCCCCCCHHH | 24.00 | 28060719 | |
82 | Phosphorylation | TCARSFPSSKALITH HCCCCCCCCHHHHHC | 42.32 | 28060719 | |
83 | Phosphorylation | CARSFPSSKALITHQ CCCCCCCCHHHHHCH | 23.37 | 28060719 | |
105 | Phosphorylation | KPTLPVATTTAQPTF CCCCCEEECCCCCCC | 25.55 | 30576142 | |
107 | Phosphorylation | TLPVATTTAQPTFPC CCCEEECCCCCCCCC | 20.95 | - | |
111 | Phosphorylation | ATTTAQPTFPCPDCG EECCCCCCCCCCCCC | 28.29 | - | |
120 | Phosphorylation | PCPDCGKTFGQAVSL CCCCCCCCHHHHHHH | 20.48 | 22817900 | |
126 | Phosphorylation | KTFGQAVSLRRHRQM CCHHHHHHHHHHHHH | 21.12 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN576_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN576_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN576_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
POGZ_HUMAN | POGZ | physical | 28514442 | |
ZN618_HUMAN | ZNF618 | physical | 28514442 | |
AJUBA_HUMAN | AJUBA | physical | 28514442 | |
ZBT40_HUMAN | ZBTB40 | physical | 28514442 | |
ZBED1_HUMAN | ZBED1 | physical | 28514442 | |
ZBT10_HUMAN | ZBTB10 | physical | 28514442 | |
LIMD1_HUMAN | LIMD1 | physical | 28514442 | |
RBBP6_HUMAN | RBBP6 | physical | 28514442 | |
PDLI7_HUMAN | PDLIM7 | physical | 28514442 | |
KAISO_HUMAN | ZBTB33 | physical | 28514442 | |
ZN446_HUMAN | ZNF446 | physical | 28514442 | |
RENT1_HUMAN | UPF1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-120 AND SER-126, ANDMASS SPECTROMETRY. |