UniProt ID | YHV5_SCHPO | |
---|---|---|
UniProt AC | Q9P7R6 | |
Protein Name | Uncharacterized protein C211.05 | |
Gene Name | SPBC211.05 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 85 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MADRLRSQAKLEQLQARYVGVGNAFTTKYEWMVNQHRDTLSSVVGHPPLLAYMATALGEPRVQVRKNLLEKMIMPCGPPPPSNQF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YHV5_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YHV5_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YHV5_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YHV5_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ADN3_SCHPO | adn3 | genetic | 22681890 | |
YNSK_SCHPO | any1 | genetic | 22681890 | |
PROD_SCHPO | SPCC70.03c | genetic | 22681890 | |
RTF2_SCHPO | rtf2 | genetic | 22681890 | |
GIT3_SCHPO | git3 | genetic | 22681890 | |
MUG80_SCHPO | mug80 | genetic | 22681890 | |
RSC4_SCHPO | rsc4 | genetic | 22681890 | |
PHD1_SCHPO | hos2 | genetic | 22681890 | |
SET3_SCHPO | set3 | genetic | 22681890 | |
NOT3_SCHPO | not3 | genetic | 22681890 | |
POF9_SCHPO | pof9 | genetic | 22681890 | |
GBB_SCHPO | git5 | genetic | 22681890 | |
GPA2_SCHPO | gpa2 | genetic | 22681890 | |
ING2_SCHPO | png2 | genetic | 22681890 | |
PANE_SCHPO | SPBPB2B2.09c | genetic | 22681890 | |
ADN2_SCHPO | adn2 | genetic | 22681890 | |
SPF31_SCHPO | spf31 | genetic | 22681890 | |
MCL1_SCHPO | mcl1 | genetic | 22681890 | |
PMT1M_SCHPO | pmt1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...