| UniProt ID | YGZG_YEAST | |
|---|---|---|
| UniProt AC | P53054 | |
| Protein Name | Putative uncharacterized protein YGL262W | |
| Gene Name | YGL262W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 175 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MRNNVTELVNSIIGVQTPGSLPDTLSGAHSLQRRISYFDVNWISWNWDNVNVDLNKEVKKSRPLLGEEDDQCMFGWFANNPGWKYYWSVTDNPDPGYKENYSDIGDENAVHGELYFNTYGGLMASVMTTKMVLNAKRQLVVIDTIVVKAICDYVMKYWKKKVNLTTISLYLMLKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YGZG_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YGZG_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YGZG_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YGZG_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GPR1_YEAST | GPR1 | genetic | 27708008 | |
| MET32_YEAST | MET32 | genetic | 27708008 | |
| RAD4_YEAST | RAD4 | genetic | 27708008 | |
| COX5B_YEAST | COX5B | genetic | 27708008 | |
| GSH1_YEAST | GSH1 | genetic | 27708008 | |
| PIR5_YEAST | YJL160C | genetic | 27708008 | |
| ELM1_YEAST | ELM1 | genetic | 27708008 | |
| YRA2_YEAST | YRA2 | genetic | 27708008 | |
| YNO0_YEAST | YNL140C | genetic | 27708008 | |
| SIN3_YEAST | SIN3 | genetic | 27708008 | |
| WHI5_YEAST | WHI5 | genetic | 27708008 | |
| PDE2_YEAST | PDE2 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...