UniProt ID | YGZG_YEAST | |
---|---|---|
UniProt AC | P53054 | |
Protein Name | Putative uncharacterized protein YGL262W | |
Gene Name | YGL262W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 175 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MRNNVTELVNSIIGVQTPGSLPDTLSGAHSLQRRISYFDVNWISWNWDNVNVDLNKEVKKSRPLLGEEDDQCMFGWFANNPGWKYYWSVTDNPDPGYKENYSDIGDENAVHGELYFNTYGGLMASVMTTKMVLNAKRQLVVIDTIVVKAICDYVMKYWKKKVNLTTISLYLMLKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YGZG_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YGZG_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YGZG_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YGZG_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GPR1_YEAST | GPR1 | genetic | 27708008 | |
MET32_YEAST | MET32 | genetic | 27708008 | |
RAD4_YEAST | RAD4 | genetic | 27708008 | |
COX5B_YEAST | COX5B | genetic | 27708008 | |
GSH1_YEAST | GSH1 | genetic | 27708008 | |
PIR5_YEAST | YJL160C | genetic | 27708008 | |
ELM1_YEAST | ELM1 | genetic | 27708008 | |
YRA2_YEAST | YRA2 | genetic | 27708008 | |
YNO0_YEAST | YNL140C | genetic | 27708008 | |
SIN3_YEAST | SIN3 | genetic | 27708008 | |
WHI5_YEAST | WHI5 | genetic | 27708008 | |
PDE2_YEAST | PDE2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...