UniProt ID | YFG5_YEAST | |
---|---|---|
UniProt AC | P43539 | |
Protein Name | Uncharacterized protein YFL065C | |
Gene Name | YFL065C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 102 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPHMFLLLHVDELSIFSAYQASLPGEKKVDTERLKRDLCPRKPIEIKYFSQICNDMMNKKDRLGDVLRVCCPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YFG5_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YFG5_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YFG5_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YFG5_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CND2_YEAST | BRN1 | genetic | 27708008 | |
LUC7_YEAST | LUC7 | genetic | 27708008 | |
TPIS_YEAST | TPI1 | genetic | 27708008 | |
SLU7_YEAST | SLU7 | genetic | 27708008 | |
CDC37_YEAST | CDC37 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
SAD1_YEAST | SAD1 | genetic | 27708008 | |
BCD1_YEAST | BCD1 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
CDC23_YEAST | CDC23 | genetic | 27708008 | |
GRP78_YEAST | KAR2 | genetic | 27708008 | |
GAA1_YEAST | GAA1 | genetic | 27708008 | |
SEC39_YEAST | SEC39 | genetic | 27708008 | |
NBP1_YEAST | NBP1 | genetic | 27708008 | |
CDC91_YEAST | GAB1 | genetic | 27708008 | |
BET5_YEAST | BET5 | genetic | 27708008 | |
RPAB3_YEAST | RPB8 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...