UniProt ID | YELB_SCHPO | |
---|---|---|
UniProt AC | O14242 | |
Protein Name | Putative pyridoxal kinase C6F6.11c | |
Gene Name | SPAC6F6.11c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 309 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Required for synthesis of pyridoxal-5-phosphate from vitamin B6.. | |
Protein Sequence | MNTTKRILAIQSSVCHGYVGNRAATFPLQLLGWDVDAIPTVELSNHAGYPIVKGRTLSAEQILDLYKGVSAANPSGYECLLTGYARGIGSVKAIMEIVRSVKSKNKKAFWVFDPVLGDNGRLYVEESIIPLYREMLPFADLITPNGFEAEILSGMRINSIDTAFKCVECLQQKYKVPRVVISSFVVEENGVEKLYCIGSSIYSKSFFVLIPVIPGIFRGTGDLFTALMAAHIAESPDCTESLASIKEDKLKKSVEMALSSVHEVIQKTADRISALGVEEYHPAYAELCIVNSQNSIIAPSKLFEAVYYY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YELB_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YELB_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YELB_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YELB_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MPH1L_SCHPO | mph1 | genetic | 22681890 | |
YG58_SCHPO | SPBC56F2.08c | genetic | 22681890 | |
YF48_SCHPO | SPAC3H5.08c | genetic | 22681890 | |
PAM17_SCHPO | pam17 | genetic | 22681890 | |
ULP2_SCHPO | ulp2 | genetic | 22681890 | |
YE08_SCHPO | SPAC17H9.08 | genetic | 22681890 | |
MSA1_SCHPO | msa1 | genetic | 22681890 | |
VPS38_SCHPO | vps38 | genetic | 22681890 | |
HUS1_SCHPO | hus1 | genetic | 22681890 | |
RL19B_SCHPO | rpl1902 | genetic | 22681890 | |
UBP2_SCHPO | ubp2 | genetic | 22681890 | |
MUG73_SCHPO | mug73 | genetic | 22681890 | |
YELB_SCHPO | SPAC6F6.11c | physical | 26771498 | |
YQ9A_SCHPO | SPCC18.10 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...