WSB1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: WSB1_MOUSE
• UniProt AC: O54927
• Protein Name: WD repeat and SOCS box-containing protein 1
• Gene Name: Wsb1
• Organism: Mus musculus (Mouse).
• Sequence Length: 421
• Protein Description: Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes type II iodothyronine deiodinase/DIO2. Confers constitutive instability to HIPK2 through proteasomal degradation (By similarity)..
• Protein Sequence: MASFPPRVNEKEIVRSRTIGELLAPAAPFDKKCGGENWTVAFAPDGSYFAWSQGYRIVKLVPWSQCRKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPPEHVIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHIEMVRDLTFAPDGSLLLVSASRDKTLRVWDLKDDGNMVKVLRAHQNWVYSCAFSPDCSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYVWDPHNGDLLMEFGHLFPSPTPIFAGGANDRWVRAVSFSHDGLHVASLADDKMVRFWRIDEDCPVQVAPLSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHICRMSIRRVMSTQEVQKLPVPSKILAFLSYRG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MASFPPRVNE -----CCCCCCCCCH	36.67	25159016
31	Ubiquitination	APAAPFDKKCGGENW CCCCCCCCCCCCCCE	50.79	-
145	Phosphorylation	QDQLLLATGLNNGRI CCEEEEEECCCCCCE	42.02	25367039
158	Phosphorylation	RIKIWDVYTGKLLLN CEEEEEHHHCHHHHH	13.80	25367039
159	Phosphorylation	IKIWDVYTGKLLLNL EEEEEHHHCHHHHHH	27.91	25367039

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of WSB1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of WSB1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of WSB1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELOB_MOUSE	Tceb2	physical	9869640
ELOC_MOUSE	Tceb1	physical	9869640
CUL5_HUMAN	CUL5	physical	15601820
RBX2_HUMAN	RNF7	physical	15601820
ELOB_HUMAN	TCEB2	physical	15601820
ELOC_HUMAN	TCEB1	physical	15601820
LRRK2_MOUSE	Lrrk2	physical	27273569

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.