UniProt ID | WNT1_MOUSE | |
---|---|---|
UniProt AC | P04426 | |
Protein Name | Proto-oncogene Wnt-1 | |
Gene Name | Wnt1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 370 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix . Secreted . | |
Protein Description | Ligand for members of the frizzled family of seven transmembrane receptors. Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation (By similarity). In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. [PubMed: 15454084] | |
Protein Sequence | MGLWALLPSWVSTTLLLALTALPAALAANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | N-linked_Glycosylation | LPAALAANSSGRWWG HHHHHHHCCCCCCEE | 30.97 | - | |
208 | Phosphorylation | HNNEAGRTTVFSEMR CCCCCCCCCHHHHHH | 26.79 | 21454597 | |
224 | O-palmitoleoylation | ECKCHGMSGSCTVRT HHHHCCCCCCCEEEE | 31.95 | - | |
316 | N-linked_Glycosylation | GTAGRACNSSSPALD CCCHHHCCCCCCCCC | 43.89 | - | |
346 | N-linked_Glycosylation | QRVTERCNCTFHWCC HHHHHHCCCEEEEEE | 33.80 | - | |
359 | N-linked_Glycosylation | CCHVSCRNCTHTRVL EEEEECCCCCCCHHH | 39.09 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WNT1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WNT1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WNT1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LRP6_MOUSE | Lrp6 | physical | 16126904 | |
FZD1_MOUSE | Fzd1 | genetic | 15143170 | |
FZD8_MOUSE | Fzd8 | genetic | 15143170 | |
LRP5_MOUSE | Lrp5 | genetic | 15143170 | |
LRP6_MOUSE | Lrp6 | genetic | 15143170 | |
DKK1_MOUSE | Dkk1 | genetic | 15143170 | |
WNT3A_MOUSE | Wnt3a | genetic | 11877374 | |
LRP6_MOUSE | Lrp6 | physical | 18505367 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...