FZD8_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FZD8_MOUSE
• UniProt AC: Q61091
• Protein Name: Frizzled-8
• Gene Name: Fzd8
• Organism: Mus musculus (Mouse).
• Sequence Length: 685
• Subcellular Localization: Membrane; Multi-pass membrane protein. Golgi apparatus. Cell membrane; Multi-pass membrane protein. Colocalizes with GOPC at the Golgi apparatus.
• Protein Description: Receptor for Wnt proteins. Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes (By similarity). The beta-catenin canonical signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Coreceptor along with RYK of Wnt proteins, such as WNT1..
• Protein Sequence: MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAAGAGAAGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGAAVGAGAGGSGPGGSGPGPGGGGGHGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	Acetylation	EITVPLCKGIGYNYT CCCHHCCCCCCCCCE	62.33	19861133
49	N-linked_Glycosylation	LCKGIGYNYTYMPNQ CCCCCCCCCEECCCC	19.91	-
152	N-linked_Glycosylation	DTLCMDYNRTDLTTA CCEEECCCCCCCCCC	35.79	-
473	N-linked_Glycosylation	AGICYVGNQSLDNLR CEEEEECCCCHHCCH	20.44	-
683	Phosphorylation	YPKQMPLSQV----- CCCCCCCCCC-----	24.03	28059163

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FZD8_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FZD8_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FZD8_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GOPC_MOUSE	Gopc	physical	11520064
WNT1_MOUSE	Wnt1	physical	15454084
RYK_MOUSE	Ryk	physical	15454084

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.