GOPC_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GOPC_MOUSE
• UniProt AC: Q8BH60
• Protein Name: Golgi-associated PDZ and coiled-coil motif-containing protein
• Gene Name: Gopc
• Organism: Mus musculus (Mouse).
• Sequence Length: 463
• Subcellular Localization: Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein. Golgi apparatus, trans-Golgi network membrane; Peripheral membrane protein. Cell junction, synapse. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell projection
• Protein Description: Plays a role in intracellular protein trafficking and degradation. May regulate CFTR chloride currents and acid-induced ASIC3 currents by modulating cell surface expression of both channels. May also regulate the intracellular trafficking of the ADR1B receptor. May play a role in autophagy. Overexpression results in CFTR intracellular retention and degradation in the lysosomes..
• Protein Sequence: MSAGGPCPAGAGGGPGGSSCPVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLEAQLVDLRSELTETQAEKVVLEKEVHEQLLQLHSTQLQLHAKTGQSVDSGAIKAKLSVHSVEDLERELEANKTEKVKEARLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGSGNSGASCKDSSGEMKMLQGYNKKAVRDAHENGDVGAAGESPLDDTAARAAHLHSLHQKKAY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSAGGPCPA ------CCCCCCCCC	35.30	-
25	Phosphorylation	SSCPVGVSPGGVSMF CCCCCCCCCCCCHHH	16.34	25293948
30	Phosphorylation	GVSPGGVSMFRWLEV CCCCCCCHHHHHHHH	18.58	25293948
94	Ubiquitination	TVSQINHKLEAQLVD HHHHHHHHHHHHHHH	43.46	22790023
152	Phosphorylation	GAIKAKLSVHSVEDL CCEEEEEEEECHHHH	19.65	28066266
155	Phosphorylation	KAKLSVHSVEDLERE EEEEEEECHHHHHHH	25.66	21183079
277	Phosphorylation	PPGHDQDSLKKSQGV CCCCCHHHHHHHCCC	36.13	25266776
303	Phosphorylation	DHEGLGISITGGKEH CCCCCEEEECCCHHH	16.58	27600695
351	Ubiquitination	NLRDTKHKEAVTILS CCCCCCCHHHHHHHH	49.26	22790023
370	Phosphorylation	EIEFEVVYVAPEVDS EEEEEEEEEECCCCC	8.96	30635358
377	Phosphorylation	YVAPEVDSDDENVEY EEECCCCCCCCCCEE	52.73	27087446
395	Phosphorylation	SGHRYRLYLDELEGS CCCEEEEEEEECCCC	11.78	25293948
402	Phosphorylation	YLDELEGSGNSGASC EEEECCCCCCCCCCC	25.98	22817900
405	Phosphorylation	ELEGSGNSGASCKDS ECCCCCCCCCCCCCC	38.98	11520064
408	Phosphorylation	GSGNSGASCKDSSGE CCCCCCCCCCCCHHH	25.81	22817900
410	Ubiquitination	GNSGASCKDSSGEMK CCCCCCCCCCHHHCH	59.14	22790023
442	Phosphorylation	DVGAAGESPLDDTAA CCCCCCCCCCCHHHH	29.82	25521595
456	Phosphorylation	ARAAHLHSLHQKKAY HHHHHHHHHHHHCCC	33.63	25521595

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GOPC_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GOPC_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GOPC_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GOPC_MOUSE	Gopc	physical	11520064

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.