UniProt ID | TRUNK_DROME | |
---|---|---|
UniProt AC | Q24155 | |
Protein Name | Protein trunk | |
Gene Name | trk | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 226 | |
Subcellular Localization | Secreted . | |
Protein Description | Required for activity of the tor receptor, could be a ligand of tor. Involved in specifying terminal body pattern.. | |
Protein Sequence | MKSQSELAIVLTWLAVLGTAQDDADYCAELSTQSLAKILGQAFNPRYMSIDPPGEPEEKSYHLGYKRSSYELPFYADSDAISVSHFPAWETNHFALVEKKKEAPRSKSLRTRSAFMDRVGHPRIDGFKQRPWECSSKINWIDLGLNYFPRYIRSIECIARKCWYDHFNCKPKSFTIKVLRRKTGSCIRINDKLILITAEKFENDYTQLWIWEEIAVNFCCECVMLY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of TRUNK_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRUNK_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRUNK_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRUNK_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KRAF1_DROME | phl | genetic | 20008569 | |
FUR2_DROME | Fur2 | genetic | 26508274 | |
SPY_DROME | sty | genetic | 10089881 | |
BCD_DROME | bcd | genetic | 10952897 | |
FUR11_DROME | Fur1 | genetic | 26508274 | |
FUR1C_DROME | Fur1 | genetic | 26508274 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...