TRUNK_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRUNK_DROME
• UniProt AC: Q24155
• Protein Name: Protein trunk
• Gene Name: trk
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 226
• Subcellular Localization: Secreted .
• Protein Description: Required for activity of the tor receptor, could be a ligand of tor. Involved in specifying terminal body pattern..
• Protein Sequence: MKSQSELAIVLTWLAVLGTAQDDADYCAELSTQSLAKILGQAFNPRYMSIDPPGEPEEKSYHLGYKRSSYELPFYADSDAISVSHFPAWETNHFALVEKKKEAPRSKSLRTRSAFMDRVGHPRIDGFKQRPWECSSKINWIDLGLNYFPRYIRSIECIARKCWYDHFNCKPKSFTIKVLRRKTGSCIRINDKLILITAEKFENDYTQLWIWEEIAVNFCCECVMLY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TRUNK_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRUNK_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRUNK_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRUNK_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KRAF1_DROME	phl	genetic	20008569
FUR2_DROME	Fur2	genetic	26508274
SPY_DROME	sty	genetic	10089881
BCD_DROME	bcd	genetic	10952897
FUR11_DROME	Fur1	genetic	26508274
FUR1C_DROME	Fur1	genetic	26508274

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.