UniProt ID | TPX1_SCHPO | |
---|---|---|
UniProt AC | O74887 | |
Protein Name | Peroxiredoxin tpx1 {ECO:0000303|PubMed:20356456} | |
Gene Name | tpx1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 192 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. [PubMed: 17409354] | |
Protein Sequence | MSLQIGKPAPDFKGTAVVNGAFEEIKLADYKGKWVFLGFYPLDFTFVCPTEIVAFSEAASKFAERNAQVILTSTDSEYSHLAFINTPRKEGGLGGINIPLLADPSHKVSRDYGVLIEDAGVAFRGLFLIDPKGVLRQITINDLPVGRSVDEALRLLDAFQFVEEHGEVCPANWHKGSDTIDTKNPEKYFSKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSLQIGKPA ------CCCCCCCCC | 29996109 | ||
15 | Phosphorylation | PAPDFKGTAVVNGAF CCCCCCCEEEECCCE | 25720772 | ||
105 | Phosphorylation | IPLLADPSHKVSRDY CCEECCCCCCCCCCC | 28889911 | ||
148 | Phosphorylation | NDLPVGRSVDEALRL CCCCCCCCHHHHHHH | 15824112 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPX1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPX1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPX1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TPX1_SCHPO | tpx1 | physical | 17409354 | |
GPX1_SCHPO | gpx1 | genetic | 24316080 | |
TRXB_SCHPO | trr1 | genetic | 24521463 | |
CATA_SCHPO | ctt1 | genetic | 24521463 | |
PMP20_SCHPO | pmp20 | genetic | 24521463 | |
GPX1_SCHPO | gpx1 | genetic | 24521463 | |
PRX_SCHPO | bcp1 | genetic | 24521463 | |
TXL1_SCHPO | txl1 | genetic | 24268782 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...