dbPTM

TRXB_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TRXB_SCHPO
UniProt AC	Q92375
Protein Name	Thioredoxin reductase
Gene Name	trr1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	322
Subcellular Localization	Cytoplasm .
Protein Description
Protein Sequence	MTHNKVVIIGSGPAGHTAAIYLARGELKPVMYEGMLANGIAAGGQLTTTTDVENFPGFPDGINGTTLTENFRAQSLRFGTEIITETVSKLDLSSRPFKYWLEGAEEEEPHTADSVILATGASARRLHITGEDTYWQAGISACAVCDGAVPIYRNKPLAVVGGGDSAAEEAQFLTKYGSKVYVLVRRDKLRASPIMAKRLLANPKVEVLWNTVAEEAQGDGKLLNNLRIKNTNTNEVSDLQVNGLFYAIGHIPATKLVAEQIELDEAGYIKTINGTPRTSIPGFFAAGDVQDKVFRQAITSAGSGCQAALLAMHYLEELEDTD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
165	Phosphorylation	AVVGGGDSAAEEAQF EEECCCCCHHHHHHH	32.43	25720772
192	Phosphorylation	RRDKLRASPIMAKRL ECCHHCCCHHHHHHH	14.44	28889911
278	Phosphorylation	TINGTPRTSIPGFFA EECCCCCCCCCCEEE	32.01	28889911
279	Phosphorylation	INGTPRTSIPGFFAA ECCCCCCCCCCEEEC	28.24	28889911
321	Phosphorylation	YLEELEDTD------ HHHHHCCCC------	33.94	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TRXB_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TRXB_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TRXB_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRX1_SCHPO	trx1	genetic	23121505
TXL1_SCHPO	txl1	genetic	23121505
TRXB_SCHPO	trr1	physical	23695164
TPX1_SCHPO	tpx1	genetic	24521463
CATA_SCHPO	ctt1	genetic	24521463
TRXB_SCHPO	trr1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TRXB_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-192; THR-278 ANDSER-279, AND MASS SPECTROMETRY.	18257517 [Abstract]