TRX1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRX1_SCHPO
• UniProt AC: O14463
• Protein Name: Thioredoxin-1
• Gene Name: trx1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 103
• Protein Description: Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions..
• Protein Sequence: MVKQVSDSSEFKSIVCQDKLVVVDFFATWCGPCKAIAPKFEQFSNTYSDATFIKVDVDQLSEIAAEAGVHAMPSFFLYKNGEKIEEIVGANPAKLEASIKANL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
61	Phosphorylation	KVDVDQLSEIAAEAG EEEHHHHHHHHHHHC	22.71	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRX1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRX1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRX1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TXL1_SCHPO	txl1	genetic	23121505
TPX1_SCHPO	tpx1	genetic	23121505
TXL1_SCHPO	txl1	genetic	24316080
AP1_SCHPO	pap1	genetic	24316080
TRX1_SCHPO	trx1	physical	24316080
TXL1_SCHPO	txl1	genetic	24268782

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.