GPX1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GPX1_SCHPO
• UniProt AC: O59858
• Protein Name: Glutathione peroxidase-like peroxiredoxin gpx1 {ECO:0000305}
• Gene Name: gpx1 {ECO:0000303|PubMed:10455235}
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 158
• Subcellular Localization: Cytoplasm . Mitochondrion .
• Protein Description: Glutathione peroxidase-like protein that protects cells during oxidative stress. Has peroxidase activity reducing hydrogen peroxide, alkyl and phospholipid hydroperoxides using preferentially thioredoxin as a reducing power. May act as a scavenger of H(2)O(2)..
• Protein Sequence: MSHFYDLAPKDKDGNPFPFSNLKGKVVLVVNTASKCGFTPQYKGLEALYQKYKDRGFIILGFPCNQFGNQEPGSDEEIAQFCQKNYGVTFPVLAKINVNGDNVDPVYQFLKSQKKQLGLERIKWNFEKFLVNRQGQVIERYSSISKPEHLENDIESVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
74	Phosphorylation	FGNQEPGSDEEIAQF CCCCCCCCHHHHHHH	53.19	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GPX1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GPX1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GPX1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRX1_SCHPO	trx1	genetic	24316080
TVP18_SCHPO	SPBC32F12.12c	physical	26771498
YOP1_SCHPO	yop1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.