YOP1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YOP1_SCHPO
• UniProt AC: Q9UU91
• Protein Name: Protein yop1
• Gene Name: yop1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 182
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein . Nucleus membrane ; Multi-pass membrane protein . Enriched at the cell equator during mitosis.
• Protein Description: Required for the correct positioning of the cellular division plane by delimiting the actomyosin ring assembly at the cell equator..
• Protein Sequence: MSFQVRVKQNMQDLDNRLAAFPQLNSLEKNFGVSKLYVFLTAAGIYALFLFLNWGGFLLTNLLAFAMPAFFSINAIETTNKADDTQWLTYYLVTSFLNVIEYWSQLILYYVPVYWLLKAIFLIWLALPKFNGATIIYRHLIRPYITPHVIRICKSVSRQNAAPAPTASSFAHTTATDIPPSI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YOP1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YOP1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YOP1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YOP1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RTN1_SCHPO	rtn1	genetic	20434336
YH75_SCHPO	scs2	genetic	23041194
YDFC_SCHPO	scs22	genetic	23041194

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.