TNFA_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TNFA_MOUSE
• UniProt AC: P06804
• Protein Name: Tumor necrosis factor
• Gene Name: Tnf
• Organism: Mus musculus (Mouse).
• Sequence Length: 235
• Subcellular Localization: Cell membrane; Single-pass type II membrane protein.; Tumor necrosis factor, membrane form: Membrane; Single-pass type II membrane protein.; Tumor necrosis factor, soluble form: Secreted.; C-domain 1: Secreted.; C-domain 2: Secreted.
• Protein Description: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells..
• Protein Sequence: MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSTESMIRD ------CCHHHHHHH	40.66	20531401
3	Phosphorylation	-----MSTESMIRDV -----CCHHHHHHHH	30.68	20531401
5	Phosphorylation	---MSTESMIRDVEL ---CCHHHHHHHHHH	21.43	20531401
20	Myristoylation	AEEALPQKMGGFQNS HHHHCCHHCCCCCCH	37.26	-
72	Phosphorylation	PNGLPLISSMAQTLT CCCCHHHHHHHHHHH	23.03	27357545
83	O-linked_Glycosylation	QTLTLRSSSQNSSDK HHHHHCCCCCCCCCC	29.52	-
86	N-linked_Glycosylation	TLRSSSQNSSDKPVA HHCCCCCCCCCCCEE	45.49	-
211	Phosphorylation	LEKGDQLSAEVNLPK ECCCCEEEEEECCCH	19.42	30635358

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
2	S	Phosphorylation	Kinase	CK1	-	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TNFA_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TNFA_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RIPK1_MOUSE	Ripk1	physical	18621737
TNR1A_MOUSE	Tnfrsf1a	physical	18621737
FADD_MOUSE	Fadd	physical	18417150
TM115_MOUSE	Tmem115	physical	19955178
RIPK1_MOUSE	Ripk1	physical	19955178
RNF31_MOUSE	Rnf31	physical	24469399
NEMO_MOUSE	Ikbkg	physical	24469399
RIPK1_MOUSE	Ripk1	physical	24469399
TRADD_MOUSE	Tradd	physical	24469399
TNR1A_MOUSE	Tnfrsf1a	physical	24469399

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.