dbPTM

TM115_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TM115_MOUSE
UniProt AC	Q9WUH1
Protein Name	Transmembrane protein 115 {ECO:0000305}
Gene Name	Tmem115 {ECO:0000312\|MGI:MGI:1930765}
Organism	Mus musculus (Mouse).
Sequence Length	350
Subcellular Localization	Golgi apparatus, Golgi stack membrane Multi-pass membrane protein .
Protein Description	May play a role in retrograde transport of proteins from the Golgi to the endoplasmic reticulum. May indirectly play a role in protein glycosylation in the Golgi..
Protein Sequence	MQRALPGARQHLGAILASASVVVKALCAVVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLATVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGALAYLLTYMASFNLVYLFTIRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVVPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLANLVHGLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSAWPSMDDDEEEAGAKTDSPLPLEEASTPPGKVTVPESSLITLETAPLL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
156	S-palmitoylation	LKQTMGDCVVLRVPQ HHHHCCCEEEEECCC	1.56	28526873
260	Phosphorylation	CQKTVKRYDVGAPSS HHCCCCCCCCCCCCC	14.84	29899451
302	Phosphorylation	LKRVEDQSAWPSMDD HHHHHHHCCCCCCCC	44.62	25777480
306	Phosphorylation	EDQSAWPSMDDDEEE HHHCCCCCCCCCHHH	24.92	25521595
318	Phosphorylation	EEEAGAKTDSPLPLE HHHHCCCCCCCCCHH	40.97	27087446
320	Phosphorylation	EAGAKTDSPLPLEEA HHCCCCCCCCCHHHC	33.30	25521595
328	Phosphorylation	PLPLEEASTPPGKVT CCCHHHCCCCCCCCC	44.73	27742792
329	Phosphorylation	LPLEEASTPPGKVTV CCHHHCCCCCCCCCC	40.32	25521595

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TM115_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TM115_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TM115_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
TAB2_MOUSE	Tab2	physical	19955178
M3K7_MOUSE	Map3k7	physical	19955178

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TM115_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-320, AND MASSSPECTROMETRY.	17242355 [Abstract]