UniProt ID | TRADD_MOUSE | |
---|---|---|
UniProt AC | Q3U0V2 | |
Protein Name | Tumor necrosis factor receptor type 1-associated DEATH domain protein | |
Gene Name | Tradd {ECO:0000312|MGI:MGI:109200} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 310 | |
Subcellular Localization | Nucleus. Cytoplasm. Cytoplasm, cytoskeleton. Shuttles between the cytoplasm and the nucleus. | |
Protein Description | Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B (By similarity). The nuclear form acts as a tumor suppressor by preventing ubiquitination and degradation of isoform p19ARF/ARF of CDKN2A by TRIP12: acts by interacting with TRIP12, leading to disrupt interaction between TRIP12 and isoform p19ARF/ARF of CDKN2A.. | |
Protein Sequence | MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRAGAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGSKFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCRALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPDGGLA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Phosphorylation | KALQTALSESGDSSD HHHHHHHHHCCCCHH | 27.53 | 26643407 | |
52 | Phosphorylation | LQTALSESGDSSDVL HHHHHHHCCCCHHHH | 44.52 | 26643407 | |
55 | Phosphorylation | ALSESGDSSDVLQIL HHHHCCCCHHHHHHH | 31.78 | 26643407 | |
56 | Phosphorylation | LSESGDSSDVLQILK HHHCCCCHHHHHHHH | 36.16 | 26643407 | |
97 | Phosphorylation | YREGALRTALQRCMA HHHHHHHHHHHHHHH | 32.35 | - | |
143 | Ubiquitination | LNYILAQKPDRLRDE HHHHHHCCCCHHCHH | 43.19 | - | |
185 | Phosphorylation | AGSKFPVSSPTEEKP CCCCCCCCCCCCCCC | 30.73 | 29233185 | |
186 | Phosphorylation | GSKFPVSSPTEEKPL CCCCCCCCCCCCCCC | 35.75 | 26824392 | |
188 | Phosphorylation | KFPVSSPTEEKPLPA CCCCCCCCCCCCCCC | 59.74 | 26643407 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRADD_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRADD_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRADD_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TRADD_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...