UniProt ID | TMM92_HUMAN | |
---|---|---|
UniProt AC | Q6UXU6 | |
Protein Name | Transmembrane protein 92 | |
Gene Name | TMEM92 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 159 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
Protein Description | ||
Protein Sequence | MSQAWVPGLAPTLLFSLLAGPQKIAAKCGLILACPKGFKCCGDSCCQENELFPGPVRIFVIIFLVILSVFCICGLAKCFCRNCREPEPDSPVDCRGPLELPSIIPPERVRVSLSAPPPPYSEVILKPSLGPTPTEPPPPYSFRPEEYTGDQRGIDNPAF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMM92_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMM92_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMM92_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
WWOX_HUMAN | WWOX | physical | 26186194 | |
NEDD4_HUMAN | NEDD4 | physical | 26186194 | |
ITCH_HUMAN | ITCH | physical | 26186194 | |
NED4L_HUMAN | NEDD4L | physical | 26186194 | |
POMT2_HUMAN | POMT2 | physical | 26186194 | |
POMT1_HUMAN | POMT1 | physical | 26186194 | |
NFIP1_HUMAN | NDFIP1 | physical | 26186194 | |
HBB_HUMAN | HBB | physical | 26186194 | |
CUED1_HUMAN | CUEDC1 | physical | 26186194 | |
CNEP1_HUMAN | CTDNEP1 | physical | 26186194 | |
WWOX_HUMAN | WWOX | physical | 28514442 | |
NED4L_HUMAN | NEDD4L | physical | 28514442 | |
NEDD4_HUMAN | NEDD4 | physical | 28514442 | |
POMT2_HUMAN | POMT2 | physical | 28514442 | |
HBB_HUMAN | HBB | physical | 28514442 | |
CUED1_HUMAN | CUEDC1 | physical | 28514442 | |
ITCH_HUMAN | ITCH | physical | 28514442 | |
POMT1_HUMAN | POMT1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...