UniProt ID | TLDC2_HUMAN | |
---|---|---|
UniProt AC | A0PJX2 | |
Protein Name | TLD domain-containing protein 2 | |
Gene Name | TLDC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 215 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MRGLRWRYTRLPSQVEDTLSGEEGNEEEEEEEAAPDPAAAPEDPTVPQLTEASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAWLLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
120 | Phosphorylation | GQIFGAFSSSAIRLS CCEEEEECHHEEECC | 28258704 | ||
121 | Phosphorylation | QIFGAFSSSAIRLSK CEEEEECHHEEECCC | 28258704 | ||
122 | Phosphorylation | IFGAFSSSAIRLSKG EEEEECHHEEECCCC | 28258704 | ||
153 | Phosphorylation | KVFKWTGSNSFFVKG EEEEECCCCCEEEEC | 21712546 | ||
155 | Phosphorylation | FKWTGSNSFFVKGDL EEECCCCCEEEECCH | 21712546 | ||
169 | Phosphorylation | LDSLMMGSGSGRFGL HHHEECCCCCCCCEE | 19053533 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TLDC2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TLDC2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TLDC2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VATC1_HUMAN | ATP6V1C1 | physical | 28514442 | |
VATD_HUMAN | ATP6V1D | physical | 28514442 | |
VATE1_HUMAN | ATP6V1E1 | physical | 28514442 | |
VATB2_HUMAN | ATP6V1B2 | physical | 28514442 | |
KLH15_HUMAN | KLHL15 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...