THI13_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: THI13_YEAST
• UniProt AC: Q07748
• Protein Name: 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI13 {ECO:0000250|UniProtKB:P43534}
• Gene Name: THI13 {ECO:0000303|PubMed:12777485}
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 340
• Protein Description: Responsible for the formation of the pyrimidine heterocycle in the thiamine biosynthesis pathway. Catalyzes the formation of hydroxymethylpyrimidine phosphate (HMP-P) from histidine and pyridoxal phosphate (PLP). The protein uses PLP and the active site histidine to form HMP-P, generating an inactive enzyme. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme..
• Protein Sequence: MSTDKITFLLNWQPTPYHIPIFLAQTKGYFKEQGLDIAILEPTNPSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITEDFQSLKGKKIGYVGEFGKIQIDELTKHYGMKPEDYTAVRCGMNVAKYIIEGKIDAGIGIECMQQVELEEYLAKQGRPASDAKMLRIDKLACLGCCCFCTVLYICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKAWKEYIDFKPQLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYTNEYLSWPEPEEVSDPLEAQRLMAIHQEKCRQEGTFKRLALPA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	N6-(pyridoxal phosphate)lysine	GKVDMGLKAMIHTLA CCCCHHHHHHHHHHH	30.13	-
62	Other	GKVDMGLKAMIHTLA CCCCHHHHHHHHHHH	30.13	-
280	Phosphorylation	HRDWKKVTGYGKRLA HCCHHHHCCCCCEEE	33.30	30377154

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of THI13_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of THI13_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of THI13_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SSD1_YEAST	SSD1	genetic	20093466
ATG32_YEAST	ATG32	genetic	20093466
RSC2_YEAST	RSC2	genetic	20093466
CND2_YEAST	BRN1	genetic	27708008
KIN28_YEAST	KIN28	genetic	27708008
FAL1_YEAST	FAL1	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
OST2_YEAST	OST2	genetic	27708008
MYO2_YEAST	MYO2	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.