| UniProt ID | THI12_YEAST | |
|---|---|---|
| UniProt AC | P42883 | |
| Protein Name | 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI12 {ECO:0000250|UniProtKB:P43534} | |
| Gene Name | THI12 {ECO:0000303|PubMed:12777485} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 340 | |
| Subcellular Localization | ||
| Protein Description | Responsible for the formation of the pyrimidine heterocycle in the thiamine biosynthesis pathway. Catalyzes the formation of hydroxymethylpyrimidine phosphate (HMP-P) from histidine and pyridoxal phosphate (PLP). The protein uses PLP and the active site histidine to form HMP-P, generating an inactive enzyme. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme.. | |
| Protein Sequence | MSTDKITFLLNWQPTPYHIPIFLAQTKGYFKEQGLDMAILEPTNPSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITEDFQSLKGKKIGYVGEFGKIQIDELTKHYGMKPEDYTAVRCGMNVAKYIIEGKIDAGIGIECMQQVELEEYLAKQGRPASDAKMLRIDKLACLGCCCFCTVLYICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKAWKEYIDFKPRLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYTNEYLSWPEPEEVSDPLEAQRLMAIHQEKCRQEGTFKRLALPA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 62 | N6-(pyridoxal phosphate)lysine | GKVDMGLKAMIHTLA CCCCHHHHHHHHHHH | 30.13 | - | |
| 62 | Other | GKVDMGLKAMIHTLA CCCCHHHHHHHHHHH | 30.13 | - | |
| 280 | Phosphorylation | HRDWKKVTGYGKRLA HCCHHHHCCCCCEEE | 33.30 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THI12_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THI12_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THI12_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UAP1_YEAST | QRI1 | genetic | 27708008 | |
| RPB1_YEAST | RPO21 | genetic | 27708008 | |
| TCPD_YEAST | CCT4 | genetic | 27708008 | |
| LCB2_YEAST | LCB2 | genetic | 27708008 | |
| RSP5_YEAST | RSP5 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| STT3_YEAST | STT3 | genetic | 27708008 | |
| PRP43_YEAST | PRP43 | genetic | 27708008 | |
| RPF2_YEAST | RPF2 | genetic | 27708008 | |
| NOP2_YEAST | NOP2 | genetic | 27708008 | |
| CAP_YEAST | SRV2 | genetic | 27708008 | |
| HRP1_YEAST | HRP1 | genetic | 27708008 | |
| RPB2_YEAST | RPB2 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
