| UniProt ID | THAP8_HUMAN | |
|---|---|---|
| UniProt AC | Q8NA92 | |
| Protein Name | THAP domain-containing protein 8 | |
| Gene Name | THAP8 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 274 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQHMGCEHWVPSCHQHLCSEHFTPSCFQWRWGVRYLRPDAVPSIFSRGPPAKSQRRTRSTQKPVSPPPPLQKNTPLPQSPAIPVSGPVRLVVLGPTSGSPKTVATMLLTPLAPAPTPERSQPEVPAQQAQTGLGPVLGALQRRVRRLQRCQERHQAQLQALERLAQQLHGESLLARARRGLQRLTTAQTLGPEESQTFTIICGGPDIAMVLAQDPAPATVDAKPELLDTRIPSA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | Ubiquitination | NRPVSFYKFPLKDGP CCCEEEEEEECCCCH | 38.20 | - | |
| 32 | Ubiquitination | SFYKFPLKDGPRLQA EEEEEECCCCHHHHH | 61.96 | - | |
| 105 | Phosphorylation | RSTQKPVSPPPPLQK CCCCCCCCCCCCCCC | 39.97 | - | |
| 139 | Phosphorylation | VLGPTSGSPKTVATM EECCCCCCCHHHHHH | 24.00 | 25627689 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THAP8_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THAP8_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THAP8_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DYL1_HUMAN | DYNLL1 | physical | 16169070 | |
| P53_HUMAN | TP53 | physical | 16169070 | |
| SETB1_HUMAN | SETDB1 | physical | 16169070 | |
| TMED9_HUMAN | TMED9 | physical | 21988832 | |
| UB2D2_HUMAN | UBE2D2 | physical | 26186194 | |
| LASP1_HUMAN | LASP1 | physical | 26186194 | |
| ANM7_HUMAN | PRMT7 | physical | 26186194 | |
| CI016_HUMAN | C9orf16 | physical | 26186194 | |
| ANM7_HUMAN | PRMT7 | physical | 28514442 | |
| UB2D2_HUMAN | UBE2D2 | physical | 28514442 | |
| LASP1_HUMAN | LASP1 | physical | 28514442 | |
| CI016_HUMAN | C9orf16 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...