UniProt ID | THAP8_HUMAN | |
---|---|---|
UniProt AC | Q8NA92 | |
Protein Name | THAP domain-containing protein 8 | |
Gene Name | THAP8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 274 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQHMGCEHWVPSCHQHLCSEHFTPSCFQWRWGVRYLRPDAVPSIFSRGPPAKSQRRTRSTQKPVSPPPPLQKNTPLPQSPAIPVSGPVRLVVLGPTSGSPKTVATMLLTPLAPAPTPERSQPEVPAQQAQTGLGPVLGALQRRVRRLQRCQERHQAQLQALERLAQQLHGESLLARARRGLQRLTTAQTLGPEESQTFTIICGGPDIAMVLAQDPAPATVDAKPELLDTRIPSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Ubiquitination | NRPVSFYKFPLKDGP CCCEEEEEEECCCCH | 38.20 | - | |
32 | Ubiquitination | SFYKFPLKDGPRLQA EEEEEECCCCHHHHH | 61.96 | - | |
105 | Phosphorylation | RSTQKPVSPPPPLQK CCCCCCCCCCCCCCC | 39.97 | - | |
139 | Phosphorylation | VLGPTSGSPKTVATM EECCCCCCCHHHHHH | 24.00 | 25627689 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THAP8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THAP8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THAP8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DYL1_HUMAN | DYNLL1 | physical | 16169070 | |
P53_HUMAN | TP53 | physical | 16169070 | |
SETB1_HUMAN | SETDB1 | physical | 16169070 | |
TMED9_HUMAN | TMED9 | physical | 21988832 | |
UB2D2_HUMAN | UBE2D2 | physical | 26186194 | |
LASP1_HUMAN | LASP1 | physical | 26186194 | |
ANM7_HUMAN | PRMT7 | physical | 26186194 | |
CI016_HUMAN | C9orf16 | physical | 26186194 | |
ANM7_HUMAN | PRMT7 | physical | 28514442 | |
UB2D2_HUMAN | UBE2D2 | physical | 28514442 | |
LASP1_HUMAN | LASP1 | physical | 28514442 | |
CI016_HUMAN | C9orf16 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...