UniProt ID | TAL2_HUMAN | |
---|---|---|
UniProt AC | Q16559 | |
Protein Name | T-cell acute lymphocytic leukemia protein 2 | |
Gene Name | TAL2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 108 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Acetylation | SAFAKLRKLIPTHPP HHHHHHHHHCCCCCC | 62.29 | 30592835 | |
31 | Phosphorylation | KLRKLIPTHPPDKKL HHHHHCCCCCCCCCC | 39.77 | - | |
36 | Acetylation | IPTHPPDKKLSKNET CCCCCCCCCCCHHHH | 62.48 | 30592839 | |
91 | Phosphorylation | LPGLEDRTLLENYQV CCCCCCCCHHHHCCC | 48.28 | 24719451 | |
100 | Phosphorylation | LENYQVPSPGPSHHI HHHCCCCCCCCCCCC | 43.57 | 8152805 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
100 | S | Phosphorylation | Kinase | MAPK3 | P27361 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAL2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAL2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RBTN1_HUMAN | LMO1 | physical | 7957052 | |
RBTN2_HUMAN | LMO2 | physical | 7957052 | |
HTF4_HUMAN | TCF12 | physical | 20211142 | |
MTG8R_HUMAN | CBFA2T2 | physical | 20211142 | |
PHS2_HUMAN | PCBD2 | physical | 20211142 | |
ITF2_HUMAN | TCF4 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...