TAF13_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TAF13_ARATH
• UniProt AC: Q6NQH4
• Protein Name: Transcription initiation factor TFIID subunit 13
• Gene Name: TAF13
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 126
• Subcellular Localization: Nucleus . Cell membrane . At the torpedo stage, localized both in the nucleus and at the plasma membrane.
• Protein Description: TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription. May be involved in polycomb repressive complex 2 (PRC2) mediated repression..
• Protein Sequence: MSNTPAAAASSSSKSKAAGTSQPQEKRKTLFQKELQHMMYGFGDEQNPLPESVALVEDIVVEYVTDLTHKAQEIGSKRGRLLVDDFLYLIRKDLPKLNRCRELLAMQEELKQARKAFDVDEKELVD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TAF13_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TAF13_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TAF13_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TAF13_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAF12_ARATH	TAF12	physical	17340043
TAF11_ARATH	TAF11	physical	17340043
TAF10_ARATH	TAFII15	physical	17340043
TA12B_ARATH	EER4	physical	17340043
TAF8_ARATH	TAF8	physical	17340043
TAF4B_ARATH	TAF4	physical	17340043
TAF14_ARATH	TAF14	physical	17340043
TA14B_ARATH	GAS41	physical	17340043
SPSA1_ARATH	SPS1F	physical	21798944
CSN5B_ARATH	CSN5B	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.