UniProt ID | TAF13_ARATH | |
---|---|---|
UniProt AC | Q6NQH4 | |
Protein Name | Transcription initiation factor TFIID subunit 13 | |
Gene Name | TAF13 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 126 | |
Subcellular Localization | Nucleus . Cell membrane . At the torpedo stage, localized both in the nucleus and at the plasma membrane. | |
Protein Description | TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription. May be involved in polycomb repressive complex 2 (PRC2) mediated repression.. | |
Protein Sequence | MSNTPAAAASSSSKSKAAGTSQPQEKRKTLFQKELQHMMYGFGDEQNPLPESVALVEDIVVEYVTDLTHKAQEIGSKRGRLLVDDFLYLIRKDLPKLNRCRELLAMQEELKQARKAFDVDEKELVD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of TAF13_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAF13_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAF13_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAF13_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TAF12_ARATH | TAF12 | physical | 17340043 | |
TAF11_ARATH | TAF11 | physical | 17340043 | |
TAF10_ARATH | TAFII15 | physical | 17340043 | |
TA12B_ARATH | EER4 | physical | 17340043 | |
TAF8_ARATH | TAF8 | physical | 17340043 | |
TAF4B_ARATH | TAF4 | physical | 17340043 | |
TAF14_ARATH | TAF14 | physical | 17340043 | |
TA14B_ARATH | GAS41 | physical | 17340043 | |
SPSA1_ARATH | SPS1F | physical | 21798944 | |
CSN5B_ARATH | CSN5B | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...