UniProt ID | TAF11_ARATH | |
---|---|---|
UniProt AC | Q9M565 | |
Protein Name | Transcription initiation factor TFIID subunit 11 | |
Gene Name | TAF11 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 210 | |
Subcellular Localization | Nucleus . | |
Protein Description | TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.. | |
Protein Sequence | MKHSKDPFEAAIEEEQEESPPESPVGGGGGGDGSEDGRIEIDQTQDEDERPVDVRRPMKKAKTSVVVTEAKNKDKDEDDEEEEENMDVELTKYPTSSDPAKMAKMQTILSQFTEDQMSRYESFRRSALQRPQMKKLLIGVTGSQKIGMPMIIVACGIAKMFVGELVETARVVMAERKESGPIRPCHIRESYRRLKLEGKVPKRSVPRLFR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAF11_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAF11_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAF11_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TAF12_ARATH | TAF12 | physical | 17340043 | |
TAF13_ARATH | TAF13 | physical | 17340043 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...