UniProt ID | TAF10_ARATH | |
---|---|---|
UniProt AC | O04173 | |
Protein Name | Transcription initiation factor TFIID subunit 10 | |
Gene Name | TAF10 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 134 | |
Subcellular Localization | Nucleus . | |
Protein Description | TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription. Involved in osmotic stress adaptation during the germination stage and in gene expression related to meristem activity and leaf development.. | |
Protein Sequence | MNHGQQSGEAKHEDDAALTEFLASLMDYTPTIPDDLVEHYLAKSGFQCPDVRLIRLVAVATQKFVADVASDALQHCKARPAPVVKDKKQQKDKRLVLTMEDLSKALREYGVNVKHPEYFADSPSTGMDPATRDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
118 | Phosphorylation | VNVKHPEYFADSPST CCCCCHHHHCCCCCC | 23776212 | ||
122 | Phosphorylation | HPEYFADSPSTGMDP CHHHHCCCCCCCCCC | 30291188 | ||
124 | Phosphorylation | EYFADSPSTGMDPAT HHHCCCCCCCCCCCC | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAF10_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAF10_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAF10_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TBP1_ARATH | TBP1 | physical | 17340043 | |
TBP2_ARATH | TBP2 | physical | 17340043 | |
TAF4_ARATH | TAF4B | physical | 17340043 | |
TAF5_ARATH | TAF5 | physical | 17340043 | |
TAF11_ARATH | TAF11 | physical | 17340043 | |
TAF12_ARATH | TAF12 | physical | 17340043 | |
TAF8_ARATH | TAF8 | physical | 17340043 | |
TAF4B_ARATH | TAF4 | physical | 17340043 | |
TA12B_ARATH | EER4 | physical | 17340043 | |
TAF8_ARATH | TAF8 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...