TBP1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TBP1_ARATH
• UniProt AC: P28147
• Protein Name: TATA-box-binding protein 1 {ECO:0000303|PubMed:19929880}
• Gene Name: TBP1 {ECO:0000303|PubMed:19929880}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 200
• Subcellular Localization: Nucleus .
• Protein Description: General transcription factor that functions at the core of the DNA-binding multiprotein factor TFIID. Binding of TFIID to the TATA box is the initial transcriptional step of the pre-initiation complex (PIC), playing a role in the activation of eukaryotic genes transcribed by RNA polymerase II..
• Protein Sequence: MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MTDQGLEGS ------CCCCCCCCC	36.71	22223895
19	Phosphorylation	VDLSKHPSGIVPTLQ CCHHHCCCCCCCHHH	40.65	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TBP1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TBP1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TBP1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAF1_ARATH	HAF01	physical	17340043

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.