UniProt ID | TBP2_ARATH | |
---|---|---|
UniProt AC | P28148 | |
Protein Name | TATA-box-binding protein 2 | |
Gene Name | TBP2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 200 | |
Subcellular Localization | Nucleus. | |
Protein Description | General transcription factor (GTF) that functions at the core of the DNA-binding multiprotein factor TFIID. Binding of TFIID to the TATA box is the initial transcriptional step of the pre-initiation complex (PIC), playing a role in the activation of eukaryotic genes transcribed by RNA polymerase II (By similarity). Interacts with TFIIB1 and is required for activated transcription and possibly basal transcription. [PubMed: 10634912 May act as GTF of RNA polymerase I-dependent transcription and rRNA synthesis. Forms a ternary complex with PBRP1 and the rDNA promoter region] | |
Protein Sequence | MADQGTEGSQPVDLTKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEHLSKLAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHSAFSSYEPELFPGLIYRMKLPKIVLLIFVSGKIVITGAKMREETYTAFENIYPVLREFRKVQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | VDLTKHPSGIVPTLQ CCCCCCCCCCCCCHH | 40.65 | 28011693 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBP2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBP2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBP2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRB2_ARATH | TRB2 | physical | 15060584 | |
TAF1_ARATH | HAF01 | physical | 17340043 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...