UniProt ID | TRB2_ARATH | |
---|---|---|
UniProt AC | Q9FJW5 | |
Protein Name | Telomere repeat-binding factor 2 | |
Gene Name | TRB2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 299 | |
Subcellular Localization | Nucleus . Nucleus, nucleolus . Chromosome . Localized to the nucleolus during interphase. | |
Protein Description | Binds preferentially double-stranded telomeric repeats, but it can also bind to the single G-rich telomeric strand.. | |
Protein Sequence | MGAPKQKWTPEEEAALKAGVLKHGTGKWRTILSDTEFSLILKSRSNVDLKDKWRNISVTALWGSRKKAKLALKRTPPGTKQDDNNTALTIVALTNDDERAKPTSPGGSGGGSPRTCASKRSITSLDKIIFEAITNLRELRGSDRTSIFLYIEENFKTPPNMKRHVAVRLKHLSSNGTLVKIKHKYRFSSNFIPAGARQKAPQLFLEGNNKKDPTKPEENGANSLTKFRVDGELYMIKGMTAQEAAEAAARAVAEAEFAITEAEQAAKEAERAEAEAEAAQIFAKAAMKALKFRIRNHPW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
103 | Phosphorylation | DDERAKPTSPGGSGG CCCCCCCCCCCCCCC | 47.01 | 25561503 | |
104 | Phosphorylation | DERAKPTSPGGSGGG CCCCCCCCCCCCCCC | 30.03 | 25561503 | |
108 | Phosphorylation | KPTSPGGSGGGSPRT CCCCCCCCCCCCCCC | 39.93 | 25561503 | |
112 | Phosphorylation | PGGSGGGSPRTCASK CCCCCCCCCCCCCCC | 17.93 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRB2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRB2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRB2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TBP2_ARATH | TBP2 | physical | 15060584 | |
TRB1_ARATH | TRB1 | physical | 15589838 | |
TRB2_ARATH | TRB2 | physical | 15589838 | |
TRB3_ARATH | TRB3 | physical | 15589838 | |
TRB1_ARATH | TRB1 | physical | 18387366 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...