| UniProt ID | TRB2_ARATH | |
|---|---|---|
| UniProt AC | Q9FJW5 | |
| Protein Name | Telomere repeat-binding factor 2 | |
| Gene Name | TRB2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 299 | |
| Subcellular Localization | Nucleus . Nucleus, nucleolus . Chromosome . Localized to the nucleolus during interphase. | |
| Protein Description | Binds preferentially double-stranded telomeric repeats, but it can also bind to the single G-rich telomeric strand.. | |
| Protein Sequence | MGAPKQKWTPEEEAALKAGVLKHGTGKWRTILSDTEFSLILKSRSNVDLKDKWRNISVTALWGSRKKAKLALKRTPPGTKQDDNNTALTIVALTNDDERAKPTSPGGSGGGSPRTCASKRSITSLDKIIFEAITNLRELRGSDRTSIFLYIEENFKTPPNMKRHVAVRLKHLSSNGTLVKIKHKYRFSSNFIPAGARQKAPQLFLEGNNKKDPTKPEENGANSLTKFRVDGELYMIKGMTAQEAAEAAARAVAEAEFAITEAEQAAKEAERAEAEAEAAQIFAKAAMKALKFRIRNHPW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 103 | Phosphorylation | DDERAKPTSPGGSGG CCCCCCCCCCCCCCC | 47.01 | 25561503 | |
| 104 | Phosphorylation | DERAKPTSPGGSGGG CCCCCCCCCCCCCCC | 30.03 | 25561503 | |
| 108 | Phosphorylation | KPTSPGGSGGGSPRT CCCCCCCCCCCCCCC | 39.93 | 25561503 | |
| 112 | Phosphorylation | PGGSGGGSPRTCASK CCCCCCCCCCCCCCC | 17.93 | 25561503 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRB2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRB2_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRB2_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TBP2_ARATH | TBP2 | physical | 15060584 | |
| TRB1_ARATH | TRB1 | physical | 15589838 | |
| TRB2_ARATH | TRB2 | physical | 15589838 | |
| TRB3_ARATH | TRB3 | physical | 15589838 | |
| TRB1_ARATH | TRB1 | physical | 18387366 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
