UniProt ID | TRB1_ARATH | |
---|---|---|
UniProt AC | Q8VWK4 | |
Protein Name | Telomere repeat-binding factor 1 | |
Gene Name | TRB1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 300 | |
Subcellular Localization | Nucleus . Nucleus, nucleolus . Chromosome . Localized to the nucleolus during interphase. | |
Protein Description | Binds preferentially double-stranded telomeric repeats.. | |
Protein Sequence | MGAPKQKWTQEEESALKSGVIKHGPGKWRTILKDPEFSGVLYLRSNVDLKDKWRNMSVMANGWGSREKSRLAVKRTFSLPKQEENSLALTNSLQSDEENVDATSGLQVSSNPPPRRPNVRLDSLIMEAIATLKEPGGCNKTTIGAYIEDQYHAPPDFKRLLSTKLKYLTSCGKLVKVKRKYRIPNSTPLSSHRRKGLGVFGGKQRTSSLPSPKTDIDEVNFQTRSQIDTEIARMKSMNVHEAAAVAAQAVAEAEAAMAEAEEAAKEAEAAEAEAEAAQAFAEEASKTLKGRNICKMMIRA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
78 | Phosphorylation | LAVKRTFSLPKQEEN EEEEEEECCCCCHHH | 43.05 | 19880383 | |
186 | Phosphorylation | RKYRIPNSTPLSSHR EEECCCCCCCCCCCC | 26.50 | 25561503 | |
187 | Phosphorylation | KYRIPNSTPLSSHRR EECCCCCCCCCCCCC | 34.58 | 25561503 | |
206 | Phosphorylation | VFGGKQRTSSLPSPK CCCCCCCCCCCCCCC | 21.85 | 25561503 | |
207 | Phosphorylation | FGGKQRTSSLPSPKT CCCCCCCCCCCCCCC | 31.87 | 25561503 | |
208 | Phosphorylation | GGKQRTSSLPSPKTD CCCCCCCCCCCCCCC | 43.62 | 25561503 | |
211 | Phosphorylation | QRTSSLPSPKTDIDE CCCCCCCCCCCCHHH | 44.30 | 30407730 | |
225 | Phosphorylation | EVNFQTRSQIDTEIA HCCCCCHHHHHHHHH | 34.57 | 25561503 | |
236 | Phosphorylation | TEIARMKSMNVHEAA HHHHHHHCCCHHHHH | 13.27 | 23111157 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRB1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRB1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRB1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRB1_ARATH | TRB1 | physical | 15589838 | |
TRB2_ARATH | TRB2 | physical | 15589838 | |
TRB3_ARATH | TRB3 | physical | 15589838 | |
POT1A_ARATH | AtPOT1a | physical | 15589838 | |
TRB1_ARATH | TRB1 | physical | 18387366 | |
TRB2_ARATH | TRB2 | physical | 18387366 | |
TRB3_ARATH | TRB3 | physical | 18387366 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...