TRB1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRB1_ARATH
• UniProt AC: Q8VWK4
• Protein Name: Telomere repeat-binding factor 1
• Gene Name: TRB1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 300
• Subcellular Localization: Nucleus . Nucleus, nucleolus . Chromosome . Localized to the nucleolus during interphase.
• Protein Description: Binds preferentially double-stranded telomeric repeats..
• Protein Sequence: MGAPKQKWTQEEESALKSGVIKHGPGKWRTILKDPEFSGVLYLRSNVDLKDKWRNMSVMANGWGSREKSRLAVKRTFSLPKQEENSLALTNSLQSDEENVDATSGLQVSSNPPPRRPNVRLDSLIMEAIATLKEPGGCNKTTIGAYIEDQYHAPPDFKRLLSTKLKYLTSCGKLVKVKRKYRIPNSTPLSSHRRKGLGVFGGKQRTSSLPSPKTDIDEVNFQTRSQIDTEIARMKSMNVHEAAAVAAQAVAEAEAAMAEAEEAAKEAEAAEAEAEAAQAFAEEASKTLKGRNICKMMIRA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
78	Phosphorylation	LAVKRTFSLPKQEEN EEEEEEECCCCCHHH	43.05	19880383
186	Phosphorylation	RKYRIPNSTPLSSHR EEECCCCCCCCCCCC	26.50	25561503
187	Phosphorylation	KYRIPNSTPLSSHRR EECCCCCCCCCCCCC	34.58	25561503
206	Phosphorylation	VFGGKQRTSSLPSPK CCCCCCCCCCCCCCC	21.85	25561503
207	Phosphorylation	FGGKQRTSSLPSPKT CCCCCCCCCCCCCCC	31.87	25561503
208	Phosphorylation	GGKQRTSSLPSPKTD CCCCCCCCCCCCCCC	43.62	25561503
211	Phosphorylation	QRTSSLPSPKTDIDE CCCCCCCCCCCCHHH	44.30	30407730
225	Phosphorylation	EVNFQTRSQIDTEIA HCCCCCHHHHHHHHH	34.57	25561503
236	Phosphorylation	TEIARMKSMNVHEAA HHHHHHHCCCHHHHH	13.27	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRB1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRB1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRB1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRB1_ARATH	TRB1	physical	15589838
TRB2_ARATH	TRB2	physical	15589838
TRB3_ARATH	TRB3	physical	15589838
POT1A_ARATH	AtPOT1a	physical	15589838
TRB1_ARATH	TRB1	physical	18387366
TRB2_ARATH	TRB2	physical	18387366
TRB3_ARATH	TRB3	physical	18387366

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.