UniProt ID | TA14B_ARATH | |
---|---|---|
UniProt AC | Q9FH40 | |
Protein Name | Transcription initiation factor TFIID subunit 14b {ECO:0000303|PubMed:15527982} | |
Gene Name | TAF14B {ECO:0000303|PubMed:15527982} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 268 | |
Subcellular Localization | Cytoplasm. Nucleus . | |
Protein Description | Negative regulator of flowering controlling the H4K5 acetylation levels in the FLC and FT chromatin. Positively regulates FLC expression. Component of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of a NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histones H4 and H2A.. | |
Protein Sequence | MTNSSSSKKQAQDQPETSEPTLKSLKTKMTKSDEKQKKLKDIEISVPIVYGNVAFWLGKKASEYQSHKWAVYVRGATNEDISVVVKKVVFQLHSSFNSPTRVIEEPPFEVSESGWGEFEIAMTLHFHSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLARVQNHPALTFPRLPSGYNLPAPMQVEDTGKKKRGDTKDHSLGQWFMSFSEADELLQLAAARQQVQAHIAKLRRQISLLEGQNQTVKTGSDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TA14B_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TA14B_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TA14B_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...