| UniProt ID | SWI5_SCHPO | |
|---|---|---|
| UniProt AC | Q9UUB7 | |
| Protein Name | Mating-type switching protein swi5 | |
| Gene Name | swi5 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 85 | |
| Subcellular Localization | ||
| Protein Description | Required for normal mating-type switching. Also involved in the rhp51-dependent recombination DNA repair pathway.. | |
| Protein Sequence | MEKSQLESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGMIGKVAEHEKCTSVELFDRFGVNGSE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SWI5_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SWI5_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWI5_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWI5_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RAD55_SCHPO | rad55 | genetic | 15466419 | |
| RAD57_SCHPO | rad57 | genetic | 14663140 | |
| MUS81_SCHPO | mus81 | genetic | 15466419 | |
| SWI2_SCHPO | swi2 | physical | 14663140 | |
| SFR1_SCHPO | sfr1 | physical | 14663140 | |
| SWI5_SCHPO | swi5 | physical | 14663140 | |
| DMC1_SCHPO | dmc1 | physical | 16921379 | |
| SFR1_SCHPO | sfr1 | physical | 16921379 | |
| SWI2_SCHPO | swi2 | physical | 17304215 | |
| SFR1_SCHPO | sfr1 | physical | 17304215 | |
| RAD57_SCHPO | rad57 | genetic | 20655467 | |
| MUS81_SCHPO | mus81 | genetic | 20655467 | |
| SFR1_SCHPO | sfr1 | physical | 20823543 | |
| SFR1_SCHPO | sfr1 | physical | 22033972 | |
| SWI5_SCHPO | swi5 | physical | 22033972 | |
| SWI6_SCHPO | swi6 | genetic | 22042869 | |
| SFR1_SCHPO | sfr1 | physical | 23324799 | |
| YF2C_SCHPO | rrp1 | physical | 23828040 | |
| YG42_SCHPO | rrp2 | physical | 23828040 | |
| SRS2_SCHPO | srs2 | genetic | 23828040 | |
| SWI10_SCHPO | swi10 | genetic | 2598273 | |
| SFR1_SCHPO | sfr1 | physical | 25165823 | |
| RAD16_SCHPO | rad16 | genetic | 25293972 | |
| SFR1_SCHPO | sfr1 | physical | 22405003 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
