UniProt ID | SWI5_SCHPO | |
---|---|---|
UniProt AC | Q9UUB7 | |
Protein Name | Mating-type switching protein swi5 | |
Gene Name | swi5 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 85 | |
Subcellular Localization | ||
Protein Description | Required for normal mating-type switching. Also involved in the rhp51-dependent recombination DNA repair pathway.. | |
Protein Sequence | MEKSQLESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGMIGKVAEHEKCTSVELFDRFGVNGSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SWI5_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SWI5_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWI5_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWI5_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAD55_SCHPO | rad55 | genetic | 15466419 | |
RAD57_SCHPO | rad57 | genetic | 14663140 | |
MUS81_SCHPO | mus81 | genetic | 15466419 | |
SWI2_SCHPO | swi2 | physical | 14663140 | |
SFR1_SCHPO | sfr1 | physical | 14663140 | |
SWI5_SCHPO | swi5 | physical | 14663140 | |
DMC1_SCHPO | dmc1 | physical | 16921379 | |
SFR1_SCHPO | sfr1 | physical | 16921379 | |
SWI2_SCHPO | swi2 | physical | 17304215 | |
SFR1_SCHPO | sfr1 | physical | 17304215 | |
RAD57_SCHPO | rad57 | genetic | 20655467 | |
MUS81_SCHPO | mus81 | genetic | 20655467 | |
SFR1_SCHPO | sfr1 | physical | 20823543 | |
SFR1_SCHPO | sfr1 | physical | 22033972 | |
SWI5_SCHPO | swi5 | physical | 22033972 | |
SWI6_SCHPO | swi6 | genetic | 22042869 | |
SFR1_SCHPO | sfr1 | physical | 23324799 | |
YF2C_SCHPO | rrp1 | physical | 23828040 | |
YG42_SCHPO | rrp2 | physical | 23828040 | |
SRS2_SCHPO | srs2 | genetic | 23828040 | |
SWI10_SCHPO | swi10 | genetic | 2598273 | |
SFR1_SCHPO | sfr1 | physical | 25165823 | |
RAD16_SCHPO | rad16 | genetic | 25293972 | |
SFR1_SCHPO | sfr1 | physical | 22405003 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...