SUC2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SUC2_ARATH
• UniProt AC: Q39231
• Protein Name: Sucrose transport protein SUC2
• Gene Name: SUC2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 512
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein .
• Protein Description: Responsible for the transport of sucrose into the cell, with the concomitant uptake of protons (symport system). Can also transport other glucosides such as maltose, arbutin (hydroquinone-beta-D-glucoside), salicin (2-(hydroxymethyl)phenyl-beta-D-glucoside), alpha-phenylglucoside, beta-phenylglucoside, alpha-paranitrophenylglucoside, beta-paranitrophenylglucoside, and paranitrophenyl-beta-thioglucoside. May also transport biotin. Required for apoplastic phloem sucrose loading in source tissues (e.g. leaves) in order to transport it to sink tissues (e.g. roots, flowers)..
• Protein Sequence: MVSHPMEKAANGASALETQTGELDQPERLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGHSMGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFFMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLIVTFVSLCYVKEKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWFPFLLFDTDWMGREVYGGNSDATATAASKKLYNDGVRAGALGLMLNAIVLGFMSLGVEWIGRKLGGAKRLWGIVNFILAICLAMTVVVTKQAENHRRDHGGAKTGPPGNVTAGALTLFAILGIPQAITFSIPFALASIFSTNSGAGQGLSLGVLNLAIVVPQMVISVGGGPFDELFGGGNIPAFVLGAIAAAVSGVLALTVLPSPPPDAPAFKATMGFH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
402	N-linked_Glycosylation	AKTGPPGNVTAGALT CCCCCCCCCHHHHHH	33.47	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SUC2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SUC2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SUC2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUC3_ARATH	SUT2	physical	12689351
SUC2_ARATH	SUC2	physical	12689351
SUC4_ARATH	SUT4	physical	12689351
HHP2_ARATH	HHP2	physical	24833385
UBC34_ARATH	UBC34	physical	24833385
CKB11_ARATH	CDKB1;1	physical	24833385
WAKLG_ARATH	AT1G16260	physical	24833385
BETL2_ARATH	AT1G29060	physical	24833385
BET12_ARATH	ATBET12	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.