SS100_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SS100_YEAST
• UniProt AC: P13130
• Protein Name: Sporulation-specific wall maturation protein
• Gene Name: SPS100
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 326
• Protein Description: Serves a protective function during the early stages of spore wall formation, and contributes to spore wall maturation..
• Protein Sequence: MKFTSVLAFFLATLTASATPLYKRQNVTSGGGTVPVIITGGPAVSGSQSNVTTTTLFNSTSTLNITQLYQIATQVNQTLQSESSSGIIIVTNWRSIETLSFFCSIVFNTSKTIVITENFLWGVPILSSSDAEGRGTLVAGRDKVVYSGVFPPYTVPVGVLSGQKNVQWFFDACEPTLIASNSTIRTQYSNFTSAQISSNASSGTNTSSSSSSPLVPIIYEEGYSQSLIQSLSSSIQGLVVVSSGTSHNSTVASWTSVDFPVVYASDGSSGHDGSGIGFISNTSIPQGAISAGYLSPIQAQTLLSIAIHNQVTSSSELQQIFPVSQQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	VLAFFLATLTASATP HHHHHHHHHHHCCCC	27.13	30377154
17	Phosphorylation	FLATLTASATPLYKR HHHHHHHCCCCCCCC	27.69	30377154
22	Phosphorylation	TASATPLYKRQNVTS HHCCCCCCCCCCCCC	12.82	30377154
26	N-linked_Glycosylation	TPLYKRQNVTSGGGT CCCCCCCCCCCCCCE	42.96	-
50	N-linked_Glycosylation	AVSGSQSNVTTTTLF CCCCCCCCCEEEEEE	27.76	-
58	N-linked_Glycosylation	VTTTTLFNSTSTLNI CEEEEEECCCCCCCH	47.71	-
64	N-linked_Glycosylation	FNSTSTLNITQLYQI ECCCCCCCHHHHHHH	35.04	-
76	N-linked_Glycosylation	YQIATQVNQTLQSES HHHHHHHHHHHHHCC	21.21	-
108	N-linked_Glycosylation	FFCSIVFNTSKTIVI HHHHHEEECCCEEEE	32.33	-
181	N-linked_Glycosylation	EPTLIASNSTIRTQY CCEEEECCCEEEEEC	33.86	-
190	N-linked_Glycosylation	TIRTQYSNFTSAQIS EEEEECCCCCEEEEE	39.00	-
199	N-linked_Glycosylation	TSAQISSNASSGTNT CEEEEECCCCCCCCC	36.73	-
205	N-linked_Glycosylation	SNASSGTNTSSSSSS CCCCCCCCCCCCCCC	41.30	-
248	N-linked_Glycosylation	VSSGTSHNSTVASWT EECCCCCCCEEEEEE	38.86	-
281	N-linked_Glycosylation	SGIGFISNTSIPQGA CCCCEEECCCCCCCC	32.79	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SS100_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SS100_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SS100_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MRM2_YEAST	MRM2	genetic	27708008
ERG3_YEAST	ERG3	genetic	27708008
PHO84_YEAST	PHO84	genetic	27708008
YP022_YEAST	YPR022C	genetic	27708008
UBQL1_HUMAN	UBQLN1	physical	27107014
C43BP_HUMAN	COL4A3BP	physical	27107014
CEP76_HUMAN	CEP76	physical	27107014

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.