UniProt ID | SMAP1_MOUSE | |
---|---|---|
UniProt AC | Q91VZ6 | |
Protein Name | Stromal membrane-associated protein 1 | |
Gene Name | Smap1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 440 | |
Subcellular Localization |
Cell membrane Peripheral membrane protein Cytoplasmic side . |
|
Protein Description | GTPase activating protein that acts on ARF6. Plays a role in clathrin-dependent endocytosis. May play a role in erythropoiesis.. | |
Protein Sequence | MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKEKEKKKDEKKREKEPEKPAKPLTTEKLPKKEEQQLEPKKSTSPKNAAEPTIDLLGLDGPAEAPVTNGNPATAPALSDDLDIFGPMISNPLPAAVMPPAQGTASVPAPATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGAQQSTPGVFMGPTNIPFTSQAPTAFQGFPSMGVPVPAAPGLIGNMMGQNTGMMVGMPMHNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWNLSQMNQQMAAMNLSSANASAGFGQPPSTTAGWSGSSSGQTLSTQLWK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Acetylation | LLREEDNKYCADCEA HHHHHHCCEECCHHC | 54.77 | 22826441 | |
32 | Phosphorylation | LREEDNKYCADCEAK HHHHHCCEECCHHCC | 10.10 | - | |
179 | Phosphorylation | QQLEPKKSTSPKNAA HHCCCCCCCCCCCCC | 40.00 | 30352176 | |
180 | Phosphorylation | QLEPKKSTSPKNAAE HCCCCCCCCCCCCCC | 58.91 | 25338131 | |
181 | Phosphorylation | LEPKKSTSPKNAAEP CCCCCCCCCCCCCCC | 40.75 | 19367708 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMAP1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMAP1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMAP1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CLCA_HUMAN | CLTA | physical | 26496610 | |
CLCB_HUMAN | CLTB | physical | 26496610 | |
CLH1_HUMAN | CLTC | physical | 26496610 | |
STOM_HUMAN | STOM | physical | 26496610 | |
PDE4D_HUMAN | PDE4D | physical | 26496610 | |
SEC62_HUMAN | SEC62 | physical | 26496610 | |
EPN4_HUMAN | CLINT1 | physical | 26496610 | |
RSRC1_HUMAN | RSRC1 | physical | 26496610 | |
GTSE1_HUMAN | GTSE1 | physical | 26496610 | |
KDIS_HUMAN | KIDINS220 | physical | 26496610 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...