| UniProt ID | SKP2A_ARATH | |
|---|---|---|
| UniProt AC | Q9LPL4 | |
| Protein Name | F-box protein SKP2A | |
| Gene Name | SKP2A | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 360 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of SCF(SKP2A) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins (including cell cycle repressors). Acts as an auxin receptor. Regulates the stability of the transcription factors E2FC and DPB, repressors of cell proliferation. Confers increase tolerance to osmotic stress by promoting cell division, especially in meristems. Promotes the formation of lateral root primordia.. | |
| Protein Sequence | MVMGGEASMELDQCFQKMKMEGISIKEWKDIPVELLMRILSLVDDRNVIVASGVCTGWRDAISFGLTRLRLSWCNNNMNSLVLSLVPKFVKLQTLNLRQDKPQLEDNAVEAIANHCHELQELDLSKSLKITDRSLYALAHGCPDLTKLNLSGCTSFSDTAIAYLTRFCRKLKVLNLCGCVKAVTDNALEAIGNNCNQMQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCVLITDESVVALADWCVHLRSLGLYYCRNITDRAMYSLAQSGVKNKPGSWKSVKKGKYDEEGLRSLNISQCTALTPSAVQAVCDSFPALHTCSGRHSLVMSGCLNLTTVHCACILQAHRAHNAVPHPAH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SKP2A_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SKP2A_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SKP2A_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SKP2A_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SKP1B_ARATH | ASK2 | physical | 21798944 | |
| SKP1A_ARATH | SKP1 | physical | 23166809 | |
| SKP1B_ARATH | ASK2 | physical | 23166809 | |
| ASK11_ARATH | SK11 | physical | 23166809 | |
| ASK12_ARATH | SK12 | physical | 23166809 | |
| ASK13_ARATH | SK13 | physical | 23166809 | |
| ASK14_ARATH | SK14 | physical | 23166809 | |
| ASK18_ARATH | SK18 | physical | 23166809 | |
| SKP1A_ARATH | SKP1 | physical | 18036202 | |
| SKP1B_ARATH | ASK2 | physical | 18036202 | |
| ASK18_ARATH | SK18 | physical | 18036202 | |
| CUL1_ARATH | CUL1 | physical | 18036202 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
