SIP18_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SIP18_YEAST
• UniProt AC: P50263
• Protein Name: Protein SIP18
• Gene Name: SIP18
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 79
• Protein Sequence: MSNMMNKFAEKLQGNDDSHQKGKNAKSSNKERDDMNMDMGMGHDQSEGGMKMGHDQSGTKMNAGRGIANDWKTYENMKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Acetylation	MMNKFAEKLQGNDDS HHHHHHHHHCCCCCH	42.55	25381059
21	2-Hydroxyisobutyrylation	GNDDSHQKGKNAKSS CCCCHHHCCCCCCCC	67.44	-
46	Phosphorylation	MGMGHDQSEGGMKMG CCCCCCCCCCCCCCC	44.24	19795423
57	Phosphorylation	MKMGHDQSGTKMNAG CCCCCCCCCCCCCCC	55.26	29136822
59	Phosphorylation	MGHDQSGTKMNAGRG CCCCCCCCCCCCCCC	32.16	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SIP18_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SIP18_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SIP18_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SEC7_YEAST	SEC7	genetic	27708008
SMC3_YEAST	SMC3	genetic	27708008
DCA13_YEAST	SOF1	genetic	27708008
COG3_YEAST	COG3	genetic	27708008
MOB1_YEAST	MOB1	genetic	27708008
NU192_YEAST	NUP192	genetic	27708008
TAD3_YEAST	TAD3	genetic	27708008
ORC1_YEAST	ORC1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.