UniProt ID | SIP18_YEAST | |
---|---|---|
UniProt AC | P50263 | |
Protein Name | Protein SIP18 | |
Gene Name | SIP18 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 79 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSNMMNKFAEKLQGNDDSHQKGKNAKSSNKERDDMNMDMGMGHDQSEGGMKMGHDQSGTKMNAGRGIANDWKTYENMKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Acetylation | MMNKFAEKLQGNDDS HHHHHHHHHCCCCCH | 42.55 | 25381059 | |
21 | 2-Hydroxyisobutyrylation | GNDDSHQKGKNAKSS CCCCHHHCCCCCCCC | 67.44 | - | |
46 | Phosphorylation | MGMGHDQSEGGMKMG CCCCCCCCCCCCCCC | 44.24 | 19795423 | |
57 | Phosphorylation | MKMGHDQSGTKMNAG CCCCCCCCCCCCCCC | 55.26 | 29136822 | |
59 | Phosphorylation | MGHDQSGTKMNAGRG CCCCCCCCCCCCCCC | 32.16 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIP18_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIP18_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIP18_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SEC7_YEAST | SEC7 | genetic | 27708008 | |
SMC3_YEAST | SMC3 | genetic | 27708008 | |
DCA13_YEAST | SOF1 | genetic | 27708008 | |
COG3_YEAST | COG3 | genetic | 27708008 | |
MOB1_YEAST | MOB1 | genetic | 27708008 | |
NU192_YEAST | NUP192 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
ORC1_YEAST | ORC1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...