UniProt ID | SIA7C_HUMAN | |
---|---|---|
UniProt AC | Q8NDV1 | |
Protein Name | Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 | |
Gene Name | ST6GALNAC3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 305 | |
Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein . |
|
Protein Description | Involved in the biosynthesis of ganglioside GD1A from GM1B. Transfers CMP-NeuAc with an alpha-2,6-linkage to GalNAc residue on NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc of glycoproteins and glycolipids. ST6GalNAcIII prefers glycolipids to glycoproteins (By similarity).. | |
Protein Sequence | MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVGRMTMIRVVSHTSVPLLLKNPDYFFKEANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGSYLSTGWFTFLLAMDACYGIHVYGMINDTYCKTEGYRKVPYHYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWTLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
148 | N-linked_Glycosylation | DYFFKEANTTIYVIW CCEECCCCCEEEEEE | 38.56 | UniProtKB CARBOHYD | |
180 | Phosphorylation | LKKTVGIYPNAQIYV HHHHHCCCCCCEEEE | 5.63 | 22817900 | |
189 | Phosphorylation | NAQIYVTTEKRMSYC CCEEEEEECCCHHCC | 29.48 | 23879269 | |
194 | Phosphorylation | VTTEKRMSYCDGVFK EEECCCHHCCCCEEE | 27.00 | 29083192 | |
195 | Phosphorylation | TTEKRMSYCDGVFKK EECCCHHCCCCEEEC | 5.80 | 29083192 | |
239 | N-linked_Glycosylation | IHVYGMINDTYCKTE EHHEEEECCCEECCC | 27.04 | UniProtKB CARBOHYD | |
301 | N-linked_Glycosylation | RIIFTHPNWTLS--- CEEEECCCCCCC--- | 36.44 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIA7C_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIA7C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIA7C_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KCC1A_HUMAN | CAMK1 | physical | 26186194 | |
SAAL1_HUMAN | SAAL1 | physical | 26186194 | |
SBP1_HUMAN | SELENBP1 | physical | 26186194 | |
PON2_HUMAN | PON2 | physical | 26186194 | |
DSG4_HUMAN | DSG4 | physical | 26186194 | |
PKP3_HUMAN | PKP3 | physical | 26186194 | |
GGT7_HUMAN | GGT7 | physical | 28514442 | |
KCC1A_HUMAN | CAMK1 | physical | 28514442 | |
DSG4_HUMAN | DSG4 | physical | 28514442 | |
PON2_HUMAN | PON2 | physical | 28514442 | |
PKP3_HUMAN | PKP3 | physical | 28514442 | |
DUS14_HUMAN | DUSP14 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...