UniProt ID | SH3G3_DROME | |
---|---|---|
UniProt AC | Q8T390 | |
Protein Name | Endophilin-A | |
Gene Name | EndoA {ECO:0000312|FlyBase:FBgn0038659} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 369 | |
Subcellular Localization |
Cytoplasm . Membrane Peripheral membrane protein . Associated with internal membranes. Expressed presynaptically at NMJs. |
|
Protein Description | Required presynaptically at the neuromuscular junction. Implicated in synaptic vesicle endocytosis.. | |
Protein Sequence | MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARAKMAAVKGISKLSGQAKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAKDDEIRGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESRPRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYVQVQVPLPNGN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
78 | Phosphorylation | VKGISKLSGQAKSNT HHHHHHHCCCCCCCC | 32.37 | 22817900 | |
276 | Phosphorylation | GGLNEDGTPSHISSS CCCCCCCCCCCCCCC | 33.66 | 19429919 | |
278 | Phosphorylation | LNEDGTPSHISSSAS CCCCCCCCCCCCCCC | 33.04 | 19429919 | |
281 | Phosphorylation | DGTPSHISSSASPLP CCCCCCCCCCCCCCC | 16.90 | 19429919 | |
282 | Phosphorylation | GTPSHISSSASPLPS CCCCCCCCCCCCCCC | 29.35 | 19429919 | |
283 | Phosphorylation | TPSHISSSASPLPSP CCCCCCCCCCCCCCC | 26.44 | 19429919 | |
285 | Phosphorylation | SHISSSASPLPSPMR CCCCCCCCCCCCCCC | 28.99 | 19429919 | |
289 | Phosphorylation | SSASPLPSPMRSPAK CCCCCCCCCCCCCCH | 38.72 | 19429919 | |
293 | Phosphorylation | PLPSPMRSPAKSMAV CCCCCCCCCCHHCCC | 23.98 | 19429919 | |
297 | Phosphorylation | PMRSPAKSMAVTPQR CCCCCCHHCCCCCHH | 17.68 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SH3G3_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SH3G3_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SH3G3_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DCHS_DROME | Hdc | physical | 14605208 | |
ARMET_DROME | Manf | physical | 14605208 | |
DORS_DROME | dl | physical | 14605208 | |
HSP7E_DROME | Hsc70-5 | physical | 14605208 | |
DYN_DROME | shi | physical | 24977345 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-285; SER-289 ANDSER-293, AND MASS SPECTROMETRY. |