UniProt ID | ARMET_DROME | |
---|---|---|
UniProt AC | Q9XZ63 | |
Protein Name | Mesencephalic astrocyte-derived neurotrophic factor homolog | |
Gene Name | Manf | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 173 | |
Subcellular Localization | Secreted . | |
Protein Description | Required during the maturation of the embryonic nervous system for maintenance of neuronal and cuticular connectivity. Essential for maintenance of dopaminergic neurons and dopamine levels.. | |
Protein Sequence | MKTWYMVVVIGFLATLAQTSLALKEEDCEVCVKTVRRFADSLDDSTKKDYKQIETAFKKFCKAQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAEKICEKLKKKDAQICDLRYEKQIDLNSVDLKKLKVRDLKKILNDWDESCDGCLEKGDFIKRIEELKPKYSRSEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | Acetylation | DSTKKDYKQIETAFK CCCHHHHHHHHHHHH | 55.74 | 21791702 | |
83 | Phosphorylation | GGLEESATGILNELS CCCHHHHHHHHHHHC | 33.75 | 22668510 | |
96 | Phosphorylation | LSKPLSWSMPAEKIC HCCCCCCCCCHHHHH | 16.12 | 22668510 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARMET_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARMET_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARMET_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ERD2_DROME | KdelR | genetic | 27365452 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...