SFH1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SFH1_SCHPO
• UniProt AC: Q9USM3
• Protein Name: Chromatin structure-remodeling complex subunit sfh1
• Gene Name: sfh1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 418
• Subcellular Localization: Nucleus . Cytoplasm .
• Protein Description: Component of the chromatin structure remodeling complex (RSC), which is involved in transcription regulation and nucleosome positioning. Controls particularly membrane and organelle development genes..
• Protein Sequence: MAQACKTTYSSRLKTGNTCLIQKNVAVSTRSHSSYTGRNSLRNVPAVNYAAFEQGEDFETPVETPEKEEEKFETDDRGLAVGRPTGNNIYPRFATKTRHIYVTDEQLKCAAEERDVYIPIRLDIELPNNYRLKDTFLWNMNEQVMTPDVFAQILCADLDLSTNVYGTQISSSIRAQIEEYAPVAEVPMPKGQEMLVVFNIQVQLAQLSYNDQVEWNLTSPLTPEEFSVLTCNDLGLSGESRPEIAYAIHECLLKLKKNACEGDLPDYDSDAVPGTKAGPRQDMDTLGALWQPVLETVSLEDAKKNENNRENLVKQWRREASKFGGFAADVSAERWRAAALGNLSQSETANLPSASVSDAQTLLEQERPRWRCRWCNVLGTGTFCVRRGPEGNKSLCNACGVAYAKTGQLPYWRKSLYT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
269	Phosphorylation	GDLPDYDSDAVPGTK CCCCCCCCCCCCCCC	22.65	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SFH1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SFH1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SFH1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SNF21_SCHPO	snf21	physical	18622392
RSC1_SCHPO	rsc1	physical	18622392
RSC9_SCHPO	rsc9	physical	18622392
RSC4_SCHPO	rsc4	physical	18622392
SSR1_SCHPO	ssr1	physical	18622392
ARP9_SCHPO	arp9	physical	18622392
SSR2_SCHPO	ssr2	physical	18622392
ARP42_SCHPO	arp42	physical	18622392
SSR3_SCHPO	ssr3	physical	18622392
SFH1_SCHPO	sfh1	physical	18622392
RSC58_SCHPO	rsc58	physical	18622392
SSR4_SCHPO	ssr4	physical	18622392

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of fission yeast.";
Wilson-Grady J.T., Villen J., Gygi S.P.;
J. Proteome Res. 7:1088-1097(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-269, AND MASSSPECTROMETRY.
PubMed: 18257517