RSPO2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RSPO2_HUMAN
• UniProt AC: Q6UXX9
• Protein Name: R-spondin-2
• Gene Name: RSPO2
• Organism: Homo sapiens (Human).
• Sequence Length: 243
• Subcellular Localization: Secreted.
• Protein Description: Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Probably also acts as a ligand for frizzled and LRP receptors..
• Protein Sequence: MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
71	Phosphorylation	RREGMRQYGECLHSC HHHHHHHHHHHHHHC	12.43	24043423
77	Phosphorylation	QYGECLHSCPSGYYG HHHHHHHHCCCCCCC	18.12	24043423
80	Phosphorylation	ECLHSCPSGYYGHRA HHHHHCCCCCCCCCC	43.70	24043423
82	Phosphorylation	LHSCPSGYYGHRAPD HHHCCCCCCCCCCCC	15.60	24043423
83	Phosphorylation	HSCPSGYYGHRAPDM HHCCCCCCCCCCCCC	15.24	24043423
160	N-linked_Glycosylation	WGTCSRNNRTCGFKW CEECCCCCCCCCEEC	39.26	UniProtKB CARBOHYD
209	Phosphorylation	HCPGGKRTPKAKEKR CCCCCCCCHHHHHHH	32.40	29116813

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RSPO2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RSPO2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RSPO2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LGR4_HUMAN	LGR4	physical	24050775
JMJD6_HUMAN	JMJD6	physical	23455924
SUV91_HUMAN	SUV39H1	physical	23455924
KR107_HUMAN	KRTAP10-7	physical	25416956
KR109_HUMAN	KRTAP10-9	physical	25416956
KR101_HUMAN	KRTAP10-1	physical	25416956
ZNRF3_HUMAN	ZNRF3	physical	24050775
FZD7_HUMAN	FZD7	physical	28600110
ZNRF3_HUMAN	ZNRF3	physical	28600110

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.