UniProt ID | RL38_DROME | |
---|---|---|
UniProt AC | Q9W5N2 | |
Protein Name | 60S ribosomal protein L38 | |
Gene Name | RpL38 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 70 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDKEKADKIKQSLPPGLQVKEVK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL38_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL38_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL38_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EI3D2_DROME | CG4810 | physical | 14605208 | |
NOTCH_DROME | N | genetic | 10353901 | |
CUT_DROME | ct | genetic | 10353901 | |
MAM_DROME | mam | genetic | 10353901 | |
VG_DROME | vg | genetic | 10353901 | |
RUNT_DROME | run | genetic | 8849891 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...