| UniProt ID | RL38_DROME | |
|---|---|---|
| UniProt AC | Q9W5N2 | |
| Protein Name | 60S ribosomal protein L38 | |
| Gene Name | RpL38 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 70 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDKEKADKIKQSLPPGLQVKEVK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL38_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL38_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL38_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| EI3D2_DROME | CG4810 | physical | 14605208 | |
| NOTCH_DROME | N | genetic | 10353901 | |
| CUT_DROME | ct | genetic | 10353901 | |
| MAM_DROME | mam | genetic | 10353901 | |
| VG_DROME | vg | genetic | 10353901 | |
| RUNT_DROME | run | genetic | 8849891 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...